Back to home

Giveaways Discord servers

Discover the best Discord servers in the giveaways category

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
U
Premium
Universal Promotions
379 votes
•
Last vote 4h ago
🎉 Universal Promotions Your Gateway to Growth! 🚀 Looking to grow your Discord server, YouTube channel, Twitch, or projects? 🌍 Then join the ultimate hub for creators, server owners, and hustlers alike! 💥 What We Offer: ✅ 24/7 Self-Promotion Channels ✅ Active Community & Supportive Vibes ✅...
advertisingcommunitygiveawaysgrowth
B
Baddies Hubs
140 votes
Last vote 16h ago
💋 WELCOME TO BADDIES HUBS 💅 👠 REBUILDING THE SERVER OF BADDIES HUB 💎 Elite Trading Forums 🎁 Exclusive Giveaways 💬 Safe Space, Real Energy https://discord.gg/E2v2MsDDch
robloxtradingbaddiesgiveawaysbaddies hubs
S
◇𝑺𝒕𝒂𝒓𝒍𝒊𝒈𝒉𝒕 𝑰𝒏𝒏◇
301 votes
Last vote 16h ago
🌌 Welcome to Starlight Inn a chill, space-themed community built for good vibes and great people. Were all about hanging out, making connections, and having fun no pressure, no cliques, just an easygoing place to be yourself. ✨ What youll find here: 🎮 Game nights and group activities 💨...
gamessocialeventsgiveawaysactive
S
Satire Kingdom
61 votes
Last vote 20h ago
This is a server for roblox, community, a shop for our services like cheap b00sts, cheap n1tr0, members, social mefia b0tting and more. Make sure to join and have fun
robloxcommunityshopgiveawayspvb
M
Muslims United-debates★Politics★religion★off topic★free speech★Giveaways🏖★Literature★Charity★
60 votes
Last vote 1d ago
A server which is for everyone be it non muslim,muslim,poet,novelist everyone can join this server and talk we have specific chats for people of all religion and novelist and poets and we do large amounts of giveaways each week through paypal and bank so join it now and enjoy and a cherry on top...
religiondebatespoliticsgiveawaysliterature
L
🌙✨Lunar Eclipse✨🌙
7,538 votes
Last vote 1d ago
Hello everyone, My name is Des the Founder of ✨lunar Eclipse ✨ this is a server where you can be at home no judgment from anyone, safe space and meet new people or friends, I just recently created it and its still a working progress but i wanna get the word out so i can see what others are into and...
gamescommunityfriendlygiveawaysstreaming
L
🏮 Liyue Harbor ✾ Genshin Impact
229 votes
Last vote 3d ago
The #1 Genshin Giveaway server, providing guaranteed free Welkins, Nitro, Primogems, and more to everyone!
genshin impactgiveawaysgaminggenshinwelkin
A
Astrocord | Discover The Darkness
19 votes
Last vote 3d ago
AstroCord is the premier platform to advertise your Discord server and attract active members. List your gaming community, anime server, NFT project, crypto group, study server, or any Discord community for free. Reach thousands of potential members actively searching for servers like...
advertisingpromotiongiveawayssupportastrocord
X
🎅🎁 Xtreme Lounge 🎁🎅 | Social・Advertising・Pfps・Gws・Events
153 votes
Last vote 4d ago
📩✎ Hi there! You have been invited to the community/advertising server: Xtreme Lounge! You wanna join us? Here are things we have to offer: 🗂️ Plenty of channels where you can discuss topics such as: anime, gaming and movies/tv shows. 🤖 Many fun bots such as OwO, Dank Memer, Pokétwo and...
communitysfwchillgiveawaysadvertising
R
RIZZ HEAVEN | Chill • E-Dating • VC • Giveaways • Friends • Giveaways
1 votes
Last vote 4d ago
✨ What We Offer: 💬 Active Voice & Text Channels - talk, vibe, and connect anytime 💞 E-Dating Allowed - flirt, match, or just have fun with friendly people 🎁 Free Nitro Giveaways & Drops - exclusive events and rewards 📨 Ask-to-DM & Ask-for-DM Channels - meet new people safely and easily 😎 Tons...
datingchillcommunityhangoutgiveaways
9
99 Nights in the Forest I Class Notifier I Tips & Tricks
750 votes
Last vote 1w ago
🎮 Welcome to the official Discord server for 99 Nights in the Forest! 🌲 A mysterious Roblox adventure where you must survive 99 nights in the forest. 🧭 What youll find here: 🌟 Tips & Tricks Get survival strategies, secret locations, and helpful advice from experienced players. Share your own...
gamesroblox99 nights in the forestgiveawayscommunity
S
𝐇𝐚𝐳𝐞 (𝟏𝟖+)
166 votes
Last vote 2w ago
We are an 18+ SFW server for chatting, making friends, and hanging out! ───⋆˖⁺‧₊☽◯☾₊‧⁺˖⋆─── ✓ No age verification to join ✓ Chill mods ✓ Nitro giveaways
communitygaminggiveawaysvcsocial
O
OBSBOT Cam Official
820 votes
Last vote 3w ago
Were excited to invite you to join our official OBSBOT community, where youll discover a space full of benefits, Support, Weekly Giveaways, and fun! Heres what youll get when you join: 🎯 Product Support & Help Center Need help with your OBSBOT device? Our community is the best place to get fast,...
giveawaysesportsupportcommunitygaming
S
𝔡𝔦𝔳𝔦𝔫𝔬𝔲𝔰
148 votes
Last vote 4w ago
🎉 🌟 Welcome to 𝔡𝔦𝔳𝔦𝔫𝔬𝔲𝔰! 🌟 🎉 🚀 We're a new and growing community built for people who just want to relax, make friends, and vibe. Whether you're into gaming, music, memes, or just chatting about life, ChillZone is the place for you! 💬 What we offer: 🫂 Friendly & inclusive...
communityfungamingvcgiveaways
P
PixelCharge | PVB | GAG | SAB | MC
32 votes
Last vote 5w ago
Best cheap services shop and community. There is shop, roblox and minecraft and an active community. Join Now!
shopgaminggiveawayseventscommunity
B
Baddies Hub
464 votes
Last vote 7w ago
A Roblox Baddies Trading Server! We offer forums to easily showcase what you're trading, exciting giveaways for active members, and a black market section for selling rare or limited items securely. Good luck with your trades!
robloxbaddiesmarkettradinggiveaways
V
Vibe - e - Pakistan
6 votes
Last vote 7w ago
A community Vibe - e - Pakistan with friendly environment where you can enjoy Chats, Gaming and events. We also do Giveaways where you can win free nitros OwO cash and much more. Join us and have fun with us!
pakistanglobalcommunityurdugiveaways
K
Kok Hard Kluster
72 votes
Last vote 11w ago
✨ Enter the Realm of Kok Hard Kluster (KOK) ✨ Where warriors unite, legends are forged, and the game never sleeps. ⚔️ Join forces with our active community of gamers, guided by experienced staff. 🎁 Take part in thrilling giveaways, epic events, and endless adventures. 🌌 Kok Hard Kluster isnt just...
gamingchillcommunityarkgiveaways
A
AdGate︱Self Promo - Youtube, Twitch, Kick, Tiktok, Instagram, x Twitter, Spotify, Soundcloud, Fiverr
14 votes
Last vote 13w ago
AdGate The Server That Helps Yours Grow! Looking for a place to advertise your Discord server, bots, YouTube,Twitch, Temu, websites, Twitter, TikTok, Instagram, and much more! You fund the place! More about us: 📈・25 Active advertising channels 🔎・Find partners, staff, and job opportunities ...
self promogiveawayscommunityadvertiseevent
A
ACNH.Hub
3 votes
Last vote 14w ago
ACNH.Hub is a vibrant and active community of players who share a passion for the beloved video game, Animal Crossing: New Horizons. As a fan-created server, it is designed to bring together players from around the world to connect, trade, and socialize. One of the unique features of the server is...
communitygaminggiveawaysanimal crossingnew horizons
M
MWZ revival
16 votes
Last vote 14w ago
In this discord server you will be able to find other players to play with ranging from easier tasks such as grinding containment in tier 3 to harder tasks such as conquering the red worm or the dark aether! There is also going to be giveaways these giveaways can range from little things such as...
gamingmwzmw3giveawayschill
K
Kageverse Café
23 votes
Last vote 15w ago
💫︰welcome to kageverse café ⋆ a soft, dreamy space where nostalgia meets vibes ⋆ Welcome to Kageverse Café ☕, a cozy corner for anime lovers, drama watchers, and chill convos. Whether you're into K/C/J-dramas, old n new anime/manga, manhwa, or just chilling and talking with people who has the...
animekdramacdramacommunitygiveaways
N
Nadya YouTube Server
825 votes
Last vote 15w ago
Be-Friends Discord Server Welcome to Be-Friends, the ultimate community hub for all giveaway enthusiasts! Join us now to participate in exciting giveaways and connect with fellow members. 🎉🎁
giveawaysfree nitrofree moneyfree ranksdiscord
N
NitroLoot | Community & Giveaways
1,442 votes
Last vote 15w ago
NitroLoot is the ultimate platform to earn free Discord Nitro by completing surveys, offers, and tasks. Simply sign up, complete easy activities, and redeem your points for Discord Nitro subscriptions. Its free, fun, and the fastest way to get your Nitro without spending a...
nitrofreegiveawaysdatingrobux
S
Soulless Harbingers
225 votes
Last vote 16w ago
Welcome to 𝗦𝗢𝗨𝗟𝗟𝗘𝗦𝗦 𝗛𝗔𝗥𝗕𝗜𝗡𝗚𝗘𝗥𝗦 In the shadows, we rise. In the light, we conquer. JOIN SOULLESS HARBINGERS a brotherhood bound by loyalty, strength, and the pursuit of greatness. Step into a world where only the strong thrive. ...
gamingcommunityrobloxgiveawaysminecraft
T
Twilight Legion || EU
28 votes
Last vote 18w ago
Egyptian Blox Fruits Crew A Fun And Calm Community To Have Fun With Blox Fruits Giveaways Monthly
gamesmusiccalm communityrobloxgiveaways
V
Valor 勇 — Roblox Fun & Chill Community
1 votes
Last vote 18w ago
❅▬▬▬▬▬▬▬▬✧❅✦❅✧▬▬▬▬▬▬▬▬❅ ✨ Join Valor 勇 Not just a server, a true community! ❅▬▬▬▬▬▬▬▬✧❅✦❅✧▬▬▬▬▬▬▬▬❅ 🎪 Grow a Garden Events and Giveaways ⚔️ Arise Support & 🛡️ Crimson Oath Guild 🤑 Promo Perks | 🤝 Partnerships 🎁 744T Scheckles & Nitro Giveaways ✅ 24/7 Staff & Chill Vibes 🔗 Were not...
robloxgiveawaysarise crossovergrow a garden stocksactive chat
C
Cheap GAG Pets!
760 votes
Last vote 19w ago
Welcome to Cheap GAG Pets, the #1 community for Grow a Garden pet players! 💰 Buy in-game pets like the Raccoon, Disco Bee, Dragonfly, Mimic Octopus, Butterfly, and more! 🎁 Weekly giveaways & discounts! 🛎️ Fast support & secure trades 🧑🌾 Whether youre new to Grow a Garden or a farming pro,...
robloxgrow a gardenpetsgiveawaysroblox grow a garden
B
Baddies Market
1 votes
Last vote 20w ago
A Roblox Baddies Trading Server! We offer forums to easily showcase what you're trading, exciting giveaways for active members, and a black market section for selling rare or limited items securely. Good luck with your trades!
robloxbaddiestradinggiveawaysmarket
C
CXK
1 votes
Last vote 20w ago
This server is a space for fans of CoryxKenshin to chill, share laughs, and vibe together. Everyones welcome just be respectful and treat others like youd want to be treated. Thats what being part of the Samurai is all about. わ﹒Custom entertainment bot with unique games せ﹒SSS, TNTL, and other...
cxkcommunitycoryxkenshingiveawaysmonsters we make
D
DmvDaee's HighRoller Hideout
1 votes
Last vote 21w ago
💎Welcome to DmvDaee's HighRoller Hideout! 💰 $1000+ Monthly Leaderboard! (https://dmvdaee.vip/roobet/leaderboard/) 🎁 Daily Streams & Giveaways! (https://kick.com/dmvdaee) 🧠 Want exclusive tips? Join the stream and level up your game! 💬 Join the Community! Hang out, chat, and never miss an...
giveawaysslotsgamblingroobetleaderboard
C
CutopiaHQ
1,851 votes
Last vote 22w ago
🧑🤝🧑 Meeting Cuties 🥰 Emojis & Stickers 💝 Friendly & Wholesome 😚 Dating 🏳️⚧️ LGBTQIA+ 🏳️🌈 Customization 🤝 Partnerships 🎥 Creators🌐 Screenshots and Pics 📸 Verified 🔞 Complex Leveling 🆙 Economy system 💵 Artworks & Commissions 🎨 Roleplay 🦊 Music bots 🎵 Giveaways & Events 🎉
socialgaminglgbtqpartnershipsgiveaways
S
sub5
1 votes
Last vote 23w ago
/Unemployed Chill, semi-toxic server. We're a small community and looking for: Active members PFP uploaders Staff who arent weird
socialgiveawayscommunityiconssemi toxic
E
euphoric | giveaways
5 votes
Last vote 23w ago
Why You Should Join Euphoric for Game Giveaways If you're a fan of games like Rainbow Six Siege, NBA 2K25, or unique Roblox hits like Steal a Brainrot and Grow A Garden, Euphoric is the place to be. Heres why: 🎮 Exclusive Giveaways for Popular Games Euphoric regularly hosts giveaways for...
gamesgiveawaysfunclipssocialize
C
Cosmora
59 votes
Last vote 25w ago
Cosmora is a dedicated community built purely on growth and socialization, here you can meet new friends, interact with multiple discord apps, enter in giveaways, participate in daily polls and questions, and get to know the staff team!
egirlcommunitysocialactivegiveaways
P
Pls Flex
3 votes
Last vote 26w ago
Welcome to Pls Flex We're a respectful and active community focused on giveaways, fun, and supporting our upcoming Roblox game. What makes us different: Anyone can host their own giveaways not just staff Invite rewards with real Robux payouts Friendly, chatty atmosphere with zero tolerance for...
robloxrobuxgiveawaysactiverobux giveaways
T
☽ ・The Yuvea Project・𓆝✧
2 votes
Last vote 27w ago
The Yuvea Project fantasy gamers 🤍 reg gw's ❕ We Have a Custom Bot, & Developing We're a Game ❕ Looking for a new game? maybe you just wanna hangout with other gamers? this is the server for you! Games We Play: siege, Warframe, Lethal Company, LoL, Ark, 7DaysToDie, The Isle...
gamesopen world survivalyuveagwsgiveaways
P
Princ3nivek's Server
1 votes
Last vote 27w ago
🚀 Welcome to the Ultimate Hangout Hub! 🎉 Join our vibrant community where epic gaming sessions, spicy memes, and chill vibes collide! Whether youre a pro gamer, a meme lord, or just here for the chaos, weve got a spot for you. Expect 🔥 events, custom bots, and a crew thats always down to clown....
musiccommunityfriendstwitch streamergiveaways
T
Trellos Psychiatric Institution
2 votes
Last vote 28w ago
Twitch Streamer SirTrellos personal giveaway server! We giveaway things such as robux, gift cards, Nitro, in-game passes, in-game items like pet simulator huges, 1b+ fruits in grow a garden, classes and trains in dead rails, nessies and Megalodons in fisch and so much more! Join now and you'll have...
robloxgiveawaysgamingcommunityadvertising
A
/Abstro [ Release ]
2,144 votes
Last vote 32w ago
Active Chats & Voice Calls Nitro & Robux Giveaways Semi Toxic Chat Large community with selife channels 13+ Discocverable Discord Server /Abstract
toxicselfiepartnershipnitrogiveaways
G
Garden of Recollection
13 votes
Last vote 34w ago
✦₊˚ 𝒲𝑒𝓁𝒸𝑜𝓂𝑒 𝓉𝑜 𝓉𝒽𝑒 𝒢𝒶𝓇𝒹𝑒𝓃 𝑜𝒻 𝑅𝑒𝒸𝑜𝓁𝓁𝑒𝒸𝓉𝒾𝑜𝓃 ༻˚₊✦ Beyond the gates of this sanctuary lies a haven for gacha wanderers, where each summon carries hope, every loss is met with understanding, and victories are celebrated together. Here, youll find a thriving community of...
gamesanimecommunitychillgiveaways
T
The Lair
1 votes
Last vote 36w ago
🔥 Welcome to The Lair The Ultimate Gaming & Social Hub! 🔥 Looking for a place to chill, game, and connect with like-minded people? Join The Lair, where gamers and social butterflies come together! 🎮 What We Offer: ✅ A friendly and active community ✅ Gaming discussions, tips, and squads ✅...
communitysocializefriendsgaminggiveaways
D
Domain Showdown's Community
1 votes
Last vote 40w ago
The official community hub for all things Domain Showdown! Stay up to date with game updates, sneak peeks, announcements, giveaways, and events. Engage with other players, share feedback, and discuss strategies as the game continues to evolve. Whether you're looking for the latest news or a place...
communityanimefightingbattlegroundsgiveaways
F
FlavaTown Deals
181 votes
Last vote 42w ago
Weve got 50% off UberEats, Free Box Meal Kit codes, and Chic-fil-A free item codes and much more thatll take your taste buds on a flavor-packed ride without breaking the bank! 🤑 FREE ORDER GIVEAWAY ENDING ON HALLOWEEN!!! 🎃 EXTRA DISCOUNTS FOR INVITES!!!
communitygiveawaysusafoodubereats
E
Echo Lounge
4 votes
Last vote 44w ago
🌊 Echo Lounge | 💬 Chat 📢 Advertise 🎁 Win 🎧 Welcome to Echo Lounge! A fun and engaging community where you can chat with friends 💬, promote your content 📢, and join exciting giveaways 🎉! We offer QOTDs ❓, FOTDs 📚, fun bots 🤖, and more. Plus, we're looking for staff 🔍 to help grow our...
communitylooking for staffchill zonegiveawayshangout
...
Discordfy Logo

The best platform to discover and promote Discord servers. Join thousands of communities and find people with the same interests.

Top Servers

  • Gaming servers
  • Anime servers
  • Minecraft servers
  • Social servers

Resources

  • Add Server
  • Premium
  • Blog
  • Support

Legal

  • Terms of Service
  • Privacy Policy
  • Guidelines

© 2025 Discordfy. All rights reserved.

Discordfy.com is not affiliated with Discord.