Discordfy Logo
AraHaftalık topPremiumSponsorlar
Ana sayfaya dön

Roleplay Discord sunucuları

roleplay kategorisindeki en iyi Discord sunucularını keşfedin

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
S
-𝚛𝚘𝚕𝚎𝚙𝚕𝚊𝚢 𝚌𝚘𝚖𝚖𝚞𝚗𝚒𝚝𝚢•
0 oylar
Hello! this is a roleplay finder server! Our server has been running up close to a year and so we'd love to welcome even more members! We have a special area for 18+ members to keep adults who dont wanna rp with minors.
roleplayoc roleplayrp finderroleplay finderomegle role play
U
Unknown Veil
0 oylar
UNKNOWN VEIL === An unknown world, yet to be discovered by the pioneers of another. After a shattering of space and time, survivors from across the multiverse gather to unearth the secrets of the New World. Your old life is history... for better or worse. Will you explore this newly birthed realm...
roleplayrpd ddndwestmarch
S
Star Trek: Phoenix
0 oylar
The year is 2481, amidst the turning tides of the Second Iconian War. Join the USS Phoenix as it boldly explores turbulent space, tackles threats and anomalies, and experiences firsthand the struggle for the very existence of the United Federation of Planets and its ideals! Star Trek: Phoenix is...
roleplayrpsci fistar trekstar trek roleplay
L
Limits Broken
0 oylar
'Hearthstone' is a center of technology and a magical marvel due to its very strategic location. Many wars have been fought around the city. As a result, many different types have interacted with the city before it became an autonomous City-State free from outside influence. To the best of its...
roleplayrpsci ficrpfantasu
T
The Lands of Atera
0 oylar
"Across all my travels, I've never seen a more beautiful sight than the world I grew up in. A world of endless promise, a place where you have the power to seize your dreams and shape reality. With wonders as far as the eye can see, painting a picture more beautiful than life itself. Seek for what...
roleplayrpfantasymedievalfantasy rp
D
🌌 D&D Arabian Nights
0 oylar
This is an Arabic-Based D&D 5e server with 100% English support! Pretty much everything is translated and can be fully played that way. نحن سيرفر جديد الى التنانين والزنارين، ونقدم مغامرات صوتية ونصية قصيرة وألعاب دور! نحن ايضا نبحث عن رواة القصص جدد ولاعبين متحمسين يريدون استكشاف العديد من عوالم...
roleplayrplfgd ddungeons and dragons
D
✱ ding! ⭑ crossover text rp
0 oylar
what's this? ⭑ characters from different universes suddenly get added to an online groupchat — upon close inspection, nobody is able to leave the chatroom. instead of the leave button, they find a button labeled " warp ", which may allow them to teleport themselves or various objects to other...
roleplaymultifandomcrossovertextingtexting roleplay
C
🏛﹒CAMP HALF BLOOD﹒⺌﹒
0 oylar
🐚﹒A book based Percy Jackson rp server! OCS are accepted! System and neurodivergent friendly Super nice and cool mods Drama will not be tolerated so expect a super chill fun server! Simple character form, and rp rules - Uhh join today to be apart of the cool kids﹒⺌﹒
roleplaycamp half bloodpercy jacksoncamp half blood rppercy jackson rp
S
𝓡𝓸𝓼𝓮𝓶𝓮𝓲𝓾𝓼 𝓐𝓬𝓪𝓭𝓮𝓶𝔂
0 oylar
. 【🌹 𝓡𝓸𝓼𝓮𝓶𝓮𝓲𝓾𝓼 𝓐𝓬𝓪𝓭𝓮𝓶𝔂 🌹】 . ================================================================================================================= You have been accepted into Rosemeius Academy, the most prestigious magical academy in all of the world of Skybound. You begin as a first...
roleplayfantasyrpgmagicmagic school
F
Fortress of the Golden Sands
0 oylar
The sands have shifted, ushering in an era of revolution and the twisting of fates... You are a native of these lands, born to one of the ancient and rich biomes therein, and it seems the call for adventure has reached you in all of its grandeur! The world is fresh, a plentiful harvest grown to...
roleplayd ddnd5ewestmarch
S
SAO: Elysium
0 oylar
O melhor e maior RPG de Mesa de Sword Art Online do Brasil! Jogue 24h com dezenas de jogadores, sistema de automação único, Bots Exclusivos, suporte ativo, comunidade engajada. Conheça o seu Kirito ou Asuna neste servidor imperdível! Ambientado mundo vasto e misterioso, totalmente ambientado no...
socialgamesroleplayrpbrasil
A
After Hours DOJ Fivem Interview Server
0 oylar
We hope to see you apart of the AHDOJ Family soon! About Us: After Hours DOJ is a FiveM Roleplay Community created back in July of 2021. We are a group that is always looking to bring people together for a great roleplay experience. Our community is a mature and safe space for all. Every member of...
roleplayfivemrecruitmentwhitelistedqb core
B
˚₊‧꒰BL33DINGHE4RT’S DOMAIN꒱‧₊˚
0 oylar
Welcome to bleeding hearts domain, where gacha creators chill and make videos! we are a friendly community, no rudeness what so ever! we would appreciate you joining our community <3
roleplaygachacreatorstiktokgachalife
S
Season infinity♾
0 oylar
Season Infinity - This roleplay takes place in a separate season from the hermitcraft seasons that we know, as to allow OC's and other mcyt creators while it still making sense! You can play as anyone your heart desires for :) What we have: -Interesting Storyline -Weekly writing prompt -A system...
socialroleplaysystem friendlyhermitcraft rpempires rp
L
Laz’s Brawlstars rp server
0 oylar
A fun brawl stars roleplay server, don’t expect much because it’s a work in progress. We have lots of channels and places where you can text, and if that isn’t your style, you can just socialize with others. We have 82 brawlers, and you can be more than one for now.
roleplaybrawlstarschaoticno advertising
S
꧁𓊈𒆜🆃🅷🅴 🅾🅲🅴🅰🅽🅸🅰🅲 🅰🆁🅲🅰🅳🅴𒆜𓊉꧂
0 oylar
[DING, DING, DING!] "Ya hear that? thats the sound of the ship bells! that also means theres a NEW MAN (or woman) ABOARD! And judging by the new face, i assume that might be you! unless you're going to dive off this ship. but before yo do, allow me to tell you what we offer!" 🌊 ★彡[ɴᴏ ᴄʟᴀɪᴍꜱ]彡★ 🌊...
roleplayrpmultifandommultiversechaos
T
🍻 The Dungeon Master's Tavern
0 oylar
Are you passionate about tabletop or online role-playing games (VTT RPG)? 😊🎲 I invite you to join this server to access dozens of free assets to illustrate your games! 🖼️🆓 This server is for both Dungeon Masters and players! 🧙‍♂️🗺️👥
roleplayrpgdnddungeons and dragonsttrpg
H
Hollow Wood Academy 🌲
0 oylar
🌲Welcome students to hollow wood academy🌲 a college for magical humans and monsters! 🌘We provide: Sfw + non-semi tox (all in good fun) -14+ Horror based school rp friendly and welcoming community Tupper based rp
roleplayrphorrorschool rphorror rp
M
⭐ Marshall RP ⭐
0 oylar
Новый проект со своим уникальным ботом, крутыми системами и большим будущим! Окунитесь в интересные сценарий от наших администраторов! Опробуйте на вкус беду 1914-ого, и холод 1950-го! Поиграйте за любую страну современности, и истории. Захватите мир либо оружием, либо дипломатией! Все в ваших...
roleplayrp
E
Elysium: Gods Among Us
0 oylar
⚔️ Experience the Adventure of a Lifetime in Elysium: Gods Among Us ⚔️ 🔱 Step into the world of Percy Jackson like never before with our revolutionary roleplay server, the first of its kind! Get ready for an exhilarating journey where you have FULL freedom to shape your character, build...
roleplaypercyjacksonpjocamphalfbloodchb
H
High School Apocalypse
0 oylar
Apocalypse, a term being where the world is coming to an end. Chaos everywhere, nowhere safe. This term comes to reality when monsters appear from nothing. The once peaceful world that was known was no more. Everyone was told to pick a card, as a video game like system appeared before them. Each...
roleplayroleplayingpartnershipsrpgapocalypse
T
The Dragon’s Dance
0 oylar
The Dragon’s Dance ━━━━━━━━━━☽【❖】☾━━━━━━━━━━ The year is 129 AC, King Viserys I Targaryen still sits on the throne though he grows weaker every day through both age and illness. In recent years, the ruling of the realm has largely fallen to Viserys’ second wife and current Queen, Alicent...
roleplayasoiafgame of thronesasoiaf rphotd rp
R
Regimental Military
0 oylar
Welcome to regimental military! We are a small server that is looking to grow! We are also looking for more military personnel. Here is what we offer: Regiments for everyone Activity every day No hassle trainings Join today to join the military!
communityroleplaymilitarygrowinv
F
Fire Emblem: Outrealms
0 oylar
Welcome to Fire Emblem: Outrealms! We are a literate, 18+ server that allows any canon characters from within the Fire Emblem franchise. Our server welcomes old and new fans of Fire Emblem alike, giving them the opportunity for some fun in-character crossover interactions! We do not allow...
roleplayrpfire emblemfire emblem rpfire emblem three houses
R
RadiantRP
0 oylar
RadiantRP | Custom Cars | House Robberies | Heists | Dynamic Drug Economy | Player-Owned Businesses RadiantRP is an exciting new FiveM server designed to immerse you in a vibrant, dynamic world. Our server boasts a variety of features to enhance your roleplaying experience, including custom cars,...
roleplayenglishfivemradiant rpradiantrp
T
The Owl House RP
0 oylar
╰┈➤ The Owl House ▓ Welcome to The Boiling Isles, where fantasy is fact and monsters lurk around every corner. ▓ Set in an alternate universe, The Owl House RP Server has an original, growing plot. ▓ Here, you can create your own witch or demon OC and join in the...
roleplayoriginal charactersthe owl housethe owl house rpthe owl house roleplay
S
starless faith
0 oylar
Clans once lived in harmony under the stars. The only enemy they found was them themselves. But they were selfish and greedy. Just not fighting didn’t mean enough to the star. They gave up on the clans. A final message was all that was left.. farewell. Some clans took this better than others… and...
roleplaywcue
A
🔱 Arcadia 🔱
0 oylar
🔱 Welcome to the Kingdom of Arcadia! It is a fantasy-themed community server where you can chill with others, find friends, and have fun. Everyone can also participate in the kingdom's lore, create their own characters, and gain ranks! What we have: 🎎 Roleplay 📖 Lore ⚔️ Events 🔶 Factions 🏹...
socialanimeroleplaychillpartnerships
S
🎃𝐒𝐏𝐎𝐎𝐊𝐘 ★ 𝐒𝐓𝐀𝐑𝐋𝐈𝐆𝐇𝐓™🎃
0 oylar
•——————•°•✿•°•——————• ╰┈➤Love to chill and rp?! ˚ ༘♡ ⋆。˚ Welcome to the official Sonic’s Starlight! ˚ ༘♡ ⋆。˚ ★·.·´ Over 99+ Emojis `·.·★ ⋆ ˚。⋆୨୧˚ Fun experience to rp & chill with everyone ˚୨୧⋆。˚ ⋆ ₓ˚. ୭ ˚○◦Custom Roles!◦○˚ ୧ .˚ₓ ·͙̩̩͙˚̩̥̩̩̩̥ Creative ideas that we’d love to hear from you...
roleplaysonicsonicthehedgehogsonicrp
V
Villains Always Win |MHA 2.0
0 oylar
〘━━━━━━ ☾༒☽☠︎☾༒☽────────〙 𝓥𝓲𝓵𝓵𝓪𝓲𝓷 𝓪𝓵𝔀𝓪𝔂𝓼 𝔀𝓲𝓷|𝓜𝓱𝓪|16+ 〘━━━━━━ ☾༒☽☠︎☾༒☽────────〙 Step into a future where legends of the past are echoes, and a new era of heroes and villains emerges. Join us in crafting a dynamic world where your creations take center stage in the battle between...
roleplayrpmy hero academiamhasystem friendly
A
Alta Assassination Academy
0 oylar
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ ✦𝕬𝖑𝖙𝖆 𝕬𝖘𝖘𝖆𝖘𝖘𝖎𝖓𝖆𝖙𝖎𝖔𝖓 𝕬𝖈𝖆𝖉𝖊𝖒𝖞✦ ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ What we have^^ -Fun rp channels -An intriguing lore -Semi active chats -A school where u can learn to b an assassin -A plethora of ooc channels memes, selfies, bots...
roleplayrpassassinsschoolaction
K
Kingdom Of Simul
0 oylar
Completely unique setting involving aspects of medieval, steampunk, modern and even a sliver of scifi, Kingdom of Simul has been almost a decade long running roleplay molded by time and players. Though primarily based on the chatroom days of yahoo, our roleplay community is a place you can drag and...
roleplayrpfantasydarkt1
V
Verdant Dynasty
0 oylar
Welcome to the Verdant Dynasty 🏰 Putting the Role back into Roleplaying since 1999. 🌿 Immerse yourself in a world where every piece and facet of lore has been shaped with soul and precision. Whether you're a seasoned roleplayer or a curious newcomer, the Verdant Dynasty invites you to explore...
roleplayrpfantasyocliterate
T
˚✧₊⁎⁺˳✧ **Twisted royals**˚✧₊⁎⁺˳✧༚
0 oylar
Anywhere in this globe, you could build your kingdom, in the sky, on land, under the ocean, Or in hell, its infinite, in each kingdom, a large portal lies, making it easier to transport to different areas far away from earth, just dont make a kingdom way too overpowered, Its extremely prohibited to...
roleplaywarfantasykingdomopen world
E
EUGC:Minecraft - Java
0 oylar
EUGC (European Gaming Community) is a Minecraft Bedrock community by Europeans, for Europeans and others! Server est. 2018 for the PS3, went on hiatus, and now we are back, rebuilt and just in time for our 4 year anniversary on Bedrock. We hope to build a new community again! Server will have...
minecraftroleplayrpsmpbedrock
C
CYBΞЯBLΛDΞ CITY
0 oylar
꧁𝕋𝕙𝕚𝕤 𝕚𝕤 𝕒 𝕊𝕗𝕨 +𝟙𝟛 ℝ𝕠𝕝𝕖𝕡𝕝𝕒𝕪/𝕊𝕠𝕔𝕚𝕒𝕝𝕚𝕫𝕚𝕟𝕘 𝕊𝕖𝕣𝕧𝕖𝕣 𝕒𝕟𝕕 𝔼𝕧𝕖𝕣𝕪𝕠𝕟𝕖 𝕚𝕤 𝕎𝕖𝕝𝕔𝕠𝕞𝕖 𝕥𝕠 𝕁𝕠𝕚𝕟 ꧂ ❦𝚆𝚑𝚊𝚝 𝚠𝚎 𝚘𝚏𝚏𝚎𝚛 ☞ Fun Bots ☞ Good Staff ☞ LGBTQ+ Friendly ☞ Non-Toxic ☞ Self Roles ☞ Ping Roles ☞ Friendly Members ☞ Memes ☞ Semi-Chaotic...
roleplayfurryfantasycyberpunksocializing
R
Reign of Stars
0 oylar
~WELCOME TO REIGN OF STARS!!~ We are a community dedicated to creating and maintaining a safe place for Warrior Cats book series fans to gather, roleplay, make meaningful friendships and have fun!! Our story takes place in the forest we all know and love, but far into the future. This leaves open...
roleplaywarrior catswarriorswarriors rpwarrior cats rp
T
Tales of Universe-162
0 oylar
Tales of Universe-162 [Marvel | FSK 12 | Custom Charaktere | Alle Schreibstile möglich] Vorwort: Heyy, ich möchte vorab einmal klarstellen, dass dieser Server komplett neu ist, was bedeutet, dass anfangs (sehr) wenige Personen auf dem Server sein werden. Wir freuen uns sehr auf (neue) Mitglieder,...
roleplayrpmarvelrollenspielmarvel rp
F
Funtom Theater
0 oylar
Hello! Welcome to Funtom Theater!! Ciel and I have partnered together to make a theater that is based in the black butler world! (If only it were Bassie instead). There will be NO Sebaciel here. You will be banned if you attempt. We hope you will join in the audience to watch the show, even...
roleplaymangacanonblack butlerkuroshitsuji
M
Multiplex
0 oylar
RECENTLY RESET! SEEKING NEWCOMERS! Tired of searching for RP servers on Disboard, only to have all of them either be horny or fandom? Sick of servers that look okay at first glance but end up being hellholes of rules, literacy requirements, and OC caps? Not here! Here, you can make and play as OCs...
roleplayrpsfwoc
S
{𝟙𝟠+} 𝔽𝕚𝕖𝕟𝕕 𝔸𝕔𝕒𝕕𝕖𝕞𝕪
0 oylar
"Ah, Fiend Academy. A place where monsters of all kinds can go to learn regardless of their differences, in the hopes of one day being able to create a greater monster society together, to go farther in life and to get rid of human prejudice. Though it may be full of chaos, I'd say it's a fine...
roleplayacademyoriginal charactersmonstermonster high
V
Valor Academy - My Hero Academia RP
0 oylar
Welcome to New York, It’s been waiting for you! Come and embark as student at the number one hero school in the world, Valor Academy! Here you’ll hone your skills, make friends, fight villains and work your way to the top as you grow! Valor Academy is a MHA inspired roleplay server. A strictly OC...
animeroleplaymy hero academiabnhamha
S
ꔫ ָ֢ ݁ ˒ 𝑀𝑒𝓇𝓂𝒶𝒾𝒹’𝓈 ❥ 𝒸𝑜𝓋𝑒 ָ֢ ݁ ˒ ꔫ
0 oylar
꒰୨୧꒱ oh, it appears yet another person has stumbled upon our lovely cove! would you like to enter? :D heres what we offer!꒰୨୧꒱ ◞ ♡‿︵‿︵an adorable, brand new ocean themed server!‿︵‿︵◞ ♡ ◞ ♡‿︵‿︵fun, expressive roles! ‿︵‿︵◞ ♡ ◞ ♡‿︵‿︵tons of bots! ‿︵‿︵◞ ♡ ◞ ♡‿︵‿︵an active owner !‿︵‿︵◞ ♡ ◞...
roleplayrplgbtqsafespacegacha
S
ɴᴀᴅɪʟʟᴏ ᴠɪᴄᴇ - ᴹᵃᶠⁱᵃ/ᶜʸᵇᵉʳᵖᵘⁿᵏ ᴿᵒˡᵉᵖˡᵃʸ
0 oylar
🌟 Welcome to Nadillo Vice – where mafia meets cyberpunk with special twists in a thrilling roleplaying adventure! 🔑 Join Nadillo Vice! Unleash Your “Alter” and Transform Nadillo Welcome to Nadillo Vice, a community of extraordinary individuals dedicated to restoring and revitalizing Nadillo...
roleplayfantasymafiaurbancyberpunk
T
Tría Vasíleia
0 oylar
═ ⋆★⋆ ═ 𝐓𝐑𝐈𝐀 𝐕𝐀𝐒𝐈𝐋𝐄𝐈𝐀 ═ ⋆★⋆ ═ So you believe in Heaven? What about Hell? Surely you believe in the supernatural at least? No? Oh well, there's a nice cozy spot waiting for you in purgatory, that is unless you choose a side. Heaven and Hell aren't usually on good terms, especially...
roleplayfantasydemonsangelsgreek gods
...
...
Discordfy Logo

Discord sunucularını keşfetmek ve tanıtmak için en iyi platform. Binlerce topluluğa katılın ve aynı ilgi alanlarına sahip insanları bulun.

En iyi sunucular

  • Oyun sunucuları
  • Anime sunucuları
  • Minecraft sunucuları
  • Sosyal sunucular

Kaynaklar

  • Sunucu ekle
  • Premium
  • Blog
  • Destek

Yasal

  • Hizmet şartları
  • Gizlilik politikası
  • Kurallar

© 2026 Discordfy. Tüm hakları saklıdır.

Discordfy.com Discord ile bağlantılı değildir.

Discordfy means Discord for you :D