Ana sayfaya dön

New Discord sunucuları

new kategorisindeki en iyi Discord sunucularını keşfedin

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
T
TBDL zone
1 oylar
Son oy 63w ago
a place for tbdl people to hang out and chat, a place for people to belong, so come join us
tbdlchatnewhangoutlgbtq
2
[21+] Clearlake Forest
54 oylar
Son oy 63w ago
🌲[21+] Clearlake Forest🌲 Welcome to Clearlake Forest, a laid-back, low-moderated 21+ server! Connect with fellow cat lovers, gamers, and social butterflies in a relaxed environment. Join us for fun conversations, future game nights, and more. 🟢 Opt in Therapy/Politics role 🟢 Extra...
gamingcommunityfriendlysmallnew
A
#attention
1 oylar
Son oy 64w ago
dont b @lame 📲 𝘵𝘩𝘪𝘴 𝘴𝘦𝘳𝘷𝘦𝘳 𝘪𝘯𝘤𝘭𝘶𝘥𝘦𝘴... ღ semi-toxic spaces : ღ daily activity pings : ღ nitro giveaways at 100 members : ღ dead chat + water pings : ...𝘢𝘯𝘥 𝘮𝘶𝘤𝘩 𝘮𝘰𝘳𝘦
egirlstoxiccommunitynewchat
S
♡♡♡
3 oylar
Son oy 64w ago
This server is mostly angelic u can come here to make friends,find your future lover and the first 100 people to join gets a special role than the other member's that join so join if u want that and if u have any questions or concerns please don't hesitate to ask the owners or staff!!
gothicactiveownercommunityfriendlynew
F
Fallout: Blazed Vegas
1 oylar
Son oy 64w ago
Helloooo welcome to a brand new place for fallout roleplay to happen the blazin vegas is an open roleplay server based off the fallout series of games its time era is within the Years of fallout new vegas offering people a chance to roleplay out the legion and NCR war with custom side plots and...
communityfalloutroleplayrpnew
C
⋆·˚˚°✦ Clare's Basement ✦°˚˚·⋆
2 oylar
Son oy 64w ago
our humor is kinda offensive but we still respect everyone <3 we try to be funny (Yes we try 💀) we allowed almost anything in this server but still you should read the Rules because we have limits owner is online most of the time and he is really cool (umm can't be sure about that) PLS JOIN WE...
soicalnewchillgames
V
Vex’
1 oylar
Son oy 65w ago
Welcome to vexx. What we offer. -Low Mod -Semi Toxic Chat -Egirls -Booster Perks and more
egirlstoxicsocialnewactive
H
Hallownest
12 oylar
Son oy 65w ago
Welcome to Hallownest! We made this server the day disboard shut down and was never able to make it on the site. hopefully we can get some members from this! ✪ 18+ social&dating server for anybody looking to make friends. ✪ BRAND new server looking for active members and friends ✪ drama free...
friendschillnewcommunity
I
Immoral
1 oylar
Son oy 65w ago
14+ low mod semi toxic server join now and get the OG role if i like you 😝 looking for mods this is NOT a dating server
friendstoxicvcsmallnew
S
𝙲𝚘𝚣𝚢 𝙵𝚛𝚒𝚎𝚗𝚍𝚜 {𝟸𝟷+}
9 oylar
Son oy 68w ago
✨ Welcome to our little treehouse, cozy friends! 🌱 This server is run by a sweet couple that hopes to build a caring & fun friend group. We know that finding friends as an adult can be really hard, so we decided to create this server to make it a little easier. If you're looking for a cozy space...
new21sfwmake friendschill
V
/vain
0 oylar
✧ would you like to join a semi-toxic server where you can meet new people ? ✧ if so, i think we might be the perfect server for you !! some stuff we offer: ╭✦ ︶꒷꒦・⎯⎯・⎯⎯・ ♡ˎˊ˗ ┇〃・ ˎ fun vc's ┇〃・ ˎ a semi toxic 13+ community ┇〃・ ˎ collab ┇〃・ ˎ perks for boosters ┇〃・ ˎ open to partnering w your...
communitynewsocialsemitoxictoxic
C
Cheap'dc #cheap
0 oylar
🔥 Welcome to Cheap dc st0re ! 🔥 💎 Your 100% legit shop for Nitro, premium accounts, and more! 💎 ✅ Why choose Cheap dc st0re ? Unbeatable prices 💸 100% safe and legal products ⚖️ Fast and reliable delivery 🚀 🛒 Join now and check out our amazing deals! LE SERVEUR NEST PAS ENCORE TERMINER,...
nitroshopcheapaccountsnew
E
Elysian Roleplay
0 oylar
Elysian is a small group of experience roleplayers who are sick of the idea of "city hopping". We make it our goal to strive for the best community driven city by offering the best quality of service to those coming to RP on our server along with keeping the idea of fluent Roleplay alive with...
roleplaynewfivemgangselysian
C
Council Of Potatoes
0 oylar
We at the Council of Potatoes are believers of the Almighty Potato and the peace they will bring to the world. Potatoes have obviously been the superior life form for years and we know to worship them. We are aiming for a nice, stable, active community that thrives on potatoes. Join and you will...
communityfriendlychatnewpotato
H
Heartfall (Hangout)
0 oylar
❤ A newly created server looking for members to make one of the best hangouts achievable. 🧡 LGBTQ+ Friendly 💛Very friendly and welcoming. 💚Features: Level Achievement Roles, Self-Roles to describe yourself, Voice Chat and Streams, and plenty of fun Bots commands. 🩵 13+ (Semi-SFW) 💙...
chatnewhangoutmake friendssilly
P
Point 🐍
0 oylar
new + improved community server looking for groups , pms and more join now and come and hangout with us
giveawaysactivenewnitrostox
F
Faye | project server
0 oylar
New server, come join us and have a chat we have level roles, the higher the level the higher the permissions you can use such as: mute, timeout etc.
communityfunnewstupid members
C
Cozy Café
0 oylar
˚₊‧꒰ა Cozy Café ໒꒱ ‧₊˚ ᰔ・︴ sfw ᰔ・︴ welcoming ᰔ・︴ friendly members ᰔ・︴ aesthetic server layout ᰔ・︴ fun bots ᰔ・︴ emojis and stickers Don’t leave just because the server is new and not active
socialchillnewhangoutcute
B
Beyond Infinity
0 oylar
Hi! We are Beyond Infinity! We are a small female owned 18+ server. Join and make friends and just have a good time! What we have to offer: •Goofy emotes and stickers • Tons of bots like Confessions, Make it a quote, .fmbot, counting, dank memes and more •Boost roles for those who boost...
communitynewchattingpartnershipsfriendship
D
Da Silliest Evah
0 oylar
𐙚˙⋆.˚ ᡣ𐭩 ༘˚⋆𐙚。⋆𖦹.✧˚ 𐙚˙⋆.˚ ᡣ𐭩 ༘˚⋆𐙚。⋆𖦹.✧ ᡣ𐭩 Hiiiiii! ⸜(。˃ ᵕ ˂ )⸝♡ We’re a very new server aiming to build a welcoming community where you can relax, unwind, and connect with people who’ll listen to you ramble about your fun (or very lame XD) interests. Whether you're looking for a place...
socialcommunityfriendschillnew
L
🎸Lovejoy Fans<3🎸
0 oylar
This is a new server ofcourse we are trying to have lovejoy fans join the server it has a bunch of games and activities we try to keep the server active but it tends to be hard thank you for understanding come join us at Lovejoy Fans ☆☆☆
communitynewkindlovejoypeople who like or love l
K
kimi wa meidou-sama emote and community server.
0 oylar
welcome! future-coming emote server! looking for new individuals for a growing community that's all! >> best place for friendship making!
communityfriendsemotesnewmake friends
P
Purple Domain
0 oylar
Welcome to the Purple Domain ━━━━━━━━━⛧ Inside the purple domain is a small group of people that are into Competitive games and Party games. We are home to all types of games like... Rainbow six siege Mario Party (Emulators online) Overwatch 2 And any other competitive games or just casual...
socialgamingchillnewmario party
M
meat grinder
0 oylar
Meat Grinder is a server anybody can join! make friends and have fun. just dont be weird… or do, we dont care. join please :3
friendsnewchattingsillymentally ill
1
@𝙘𝙪𝙩𝙚𝙨𝙮 𝙘𝙖𝙛𝙚 | 13+
0 oylar
@ /𝘤𝘶𝘵𝘪𝘦𝘴!♡ ☆ emotes﹒non-tox ﹒friendly ﹒ themed ❥︎ ﹒13+ ︶︶  ˚ join us for a kiss!¡
new13sfwcute corenon tox
S
Sebby's Friends and Tourneys
0 oylar
Hey everyone. This is a new Discord Server! We are starting to do roblox tournaments and hangouts. We are also hosting giveaways when we reach a cetrain amount or members. Come join and give us a chance!
friendlyrobloxtournamentsactivenew
C
cult
0 oylar
rules: be 13-15. don’t start fights. have drama with people in the server? keep it in dms and/or tell me about it if you want the people banned. swear words and slurs are allowed, just use them appropriately nd at correct times. this server is not nsfw, don’t post nsfw content. don’t spam except in...
chillnew1413 1515
E
Ersatz ﹒❀﹒GW
0 oylar
A new sally server!! We offer ; ☆ semi Active staff ☆ Giveaways ☆ 13 - 18 + Please note that we are a new server!!
friendsgiveawaysnewhang outsally face
T
The Basement
0 oylar
ngl i have no idea what to put here just join we aint gonna kidnap you or anything (trust)
chillmuslimarabpoliticsnew
G
Gooberz Inc.
0 oylar
Do you want friends to talk with and have fun with bots? Don’t hesitate, join my server! We’re looking for: -Members -Boosts -Staff We give you: -Bots -Playful channels -(very soon to come) Friends to talk to! SO, don’t hesitate, and join our server!
communitynewnew server
L
🩷lovely cottage🩷
0 oylar
Welcome to art cottage!! This is a new server so I'd really appreciate if you joined and helped me once we get a good community I'll have applications for mods and other things !
friendlynewart cottage vent calm
U
Undestined.
0 oylar
⋆・゚:⋆・゚☽ { Undestined } ☾ ⋆・゚:⋆・゚ Undestined is a roblox server made for the Roblox game, Evade. we post news on evade and plan on hosting events/giveaways when we grow! we are new so the server is still being added onto here and there :D join now for a special "OG" role !!
friendlyrobloxnewsmallevade
P
Polymorph Society
0 oylar
Ειμαστε ενας νεος community server με στοχο να δημιουργησουμε μια μικρη κοινοτητα και να περναμε ολοι μαζι καλα!
communitygamingnewfamilyfriendlygreek
S
𝓢𝓮𝓮 𝔂𝓸𝓾 𝓪𝓽 𝓢𝓾𝓷𝓻𝓲𝓼𝓮 ~ ⋆☀.☁⋆.
0 oylar
🌟 Welcome to "𝓢𝓮𝓮 𝔂𝓸𝓾 𝓪𝓽 𝓢𝓾𝓷𝓻𝓲𝓼𝓮" - Where Sparks Ignite! 🌟 Hello lovely singles and potential soulmates! 🌹 Are you ready to embark on a journey of love and connection? Look no further than "𝓢𝓮𝓮 𝔂𝓸𝓾 𝓪𝓽 𝓢𝓾𝓷𝓻𝓲𝓼𝓮," your go-to matchmaking haven on Discord! 💑 Our...
socialdatinglovenewmatchmaking
L
Lethal Roll Community
0 oylar
Just a new game's community slowly building up, Looking for active and chatty players, friendly members and to build a small but enjoyable community around that game we made
communitysurvivalrobloxnewhiring
G
Genesis Roleplay
0 oylar
🌟 Welcome to Genesis Roleplay! 🌟 Looking for an exciting FiveM experience? Join us at Genesis Roleplay, a British based community where the possibilities are endless! 🏙️ Custom Counties & Cities: Explore our meticulously crafted world with unique locations waiting to be discovered. 👕 Custom...
roleplaynewfivemgtarpuk rp
N
༺Nightfall Romance༻
0 oylar
Okay, let me guess: you’re checking out my server to see if it’s worth joining, right? Here’s the deal: Do you want to get matched with someone quickly? I’ll take that as a yes. So here’s what you should do: Join my server and get matched and I get a member
datinganimenewmatchmakingdashbord
R
Radiant
0 oylar
join our super ultra very cool server if ur a sigma alpha person 😋😋 (need 100 characters ignore this 😔😔😔)
friendlynewsmallmake friends
G
giddy kitties
0 oylar
pretty active and mostly eastern time zone server. need laid back people who will be active, not a lot of rules just be decent :b we get real freakyyy 😛 real SILLY... dont join if you're dry 💔 -emojis -reaction roles -chill -semi-toxic (??) -bots -suggestion channel
funnychillnewsmallsemi active
P
/parks  •ﻌ•
0 oylar
‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎ ‎‎ . gw at 100 members . We're from /parks, a semi-tox server leaning towards non-tox. looking for friends, chatters, giveaways. . We're a new server thats looking to grow more and more so come, join us! . <3
socialchatemojisnewgoth
S
Stogram
0 oylar
GREATEST SERVER ON HERE!! JOIN!! Friendly and talkative members and mods, you will feel great like its your home. 💯🥶 -Safe space for everyone! It's a wholesome place don't be shy. -Goated emotes, members, channels.. EVERYTHING -Free speech btw, shit talking btw JOIN NOW!!! JOIN NOWWWWW!!! you...
friendsnewchattingsillymentally ill
I
Ijvanda Empire (LoS)
0 oylar
IjvandaEmpire.aternos.me ALL THIS IN FABRIC VANILLA COMPATIBLE SERVER 𝐕𝐞𝐫𝐬𝐢𝐨𝐧 𝟏.𝟖 - 𝟏.𝟏𝟕.𝟏 1.18 Terrain Generations 𝐎𝐮𝐫 𝐒𝐞𝐫𝐯𝐞𝐫 𝐈𝐬 𝐀 𝐅𝐮𝐧 𝐀𝐧𝐝 𝐅𝐫𝐢𝐞𝐧𝐝𝐥𝐲 𝐂𝐨𝐦𝐦𝐮𝐧𝐢𝐭𝐲 𝐖𝐞 𝐎𝐟𝐟𝐞𝐫 𝐘𝐨𝐮:- ▶️ 𝟷𝟺𝟹 𝙽𝚎𝚠 𝚂𝚝𝚛𝚞𝚌𝚝𝚞𝚛𝚎𝚜 𝚆𝚒𝚝𝚑 𝙾𝙿...
minecraftnewbestkingdomsores
P
PunkKat's Pad
0 oylar
From Disboard: A new 21+ NA based server looking for people who wanna have good convos, are active, kind/supportive, and love to chat! We're Non-toxic AND for making long term friendships! (I made this to find friends but hope anyone who joins can too!) Are you tired of toxic communities with...
friendsnewsmallwholesome21
A
♡ Asylum ♡
0 oylar
HELLO!!! JOIN MY SERVER AND FIND NEW PPL TO GAME WITH!! REQUIREMENTS must be 17+ girls only must be active!
gamingnewpartnerships16girls only
G
German Lesbians <3
0 oylar
Hey, Hier bei uns kannst du andere queere Menschen kennenlernen und dich austauschen. Wir sind eine sehr aktive Community mit ein paar verrückten Leuten, die alle sehr freundlich sind! (^▽^)/★☆♪ Aufgrund der Richtlinien von Discord ist unser Server ab 16. Der server soll ein Safe Space für unsere...
lesbiannewgermanwlwsapphic
Discordfy Logo

Discord sunucularını keşfetmek ve tanıtmak için en iyi platform. Binlerce topluluğa katılın ve aynı ilgi alanlarına sahip insanları bulun.

En iyi sunucular

  • Oyun sunucuları
  • Anime sunucuları
  • Minecraft sunucuları
  • Sosyal sunucular

Kaynaklar

  • Sunucu ekle
  • Premium
  • Blog
  • Destek

Yasal

  • Hizmet şartları
  • Gizlilik politikası
  • Kurallar

© 2025 Discordfy. Tüm hakları saklıdır.

Discordfy.com Discord ile bağlantılı değildir.

Discordfy means Discord for you :D