Ana sayfaya dön

Active Discord sunucuları

active kategorisindeki en iyi Discord sunucularını keşfedin

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
G
Garden of Khadijah
2 oylar
Son oy 51w ago
✨ Assalamu Alaikum! Welcome to Garden of Khadijah – A Safe, Supportive Space for Muslimahs, reverts, or girls/women wanting to learn more about Islam! ✨ 🌸 Are you looking for a community of sisters who uplift, inspire, and grow together in faith? 🌸 Join our girls-only Muslimah server, a cozy...
activemuslimgirls onlyrevertsmuslimah
I
ikigai
1 oylar
Son oy 51w ago
this is a fun, mainly-active server. We have icons, gws, and fun emotes too! pls join nd boost. We’ll also have movie nights or fun games to play in vc!
socialemotesactiveiconsgws
D
Darkness' Corner
1 oylar
Son oy 51w ago
⛓ Darkness' Corner ⛓ Why hello, there! Darkness' Corner is an ever-evolving, active and welcoming server full of flowing text chats, fun games and bot commands, aswell as a whole bunch of friendly faces. However, toxicity has no room in this corner. ⛓Darkness' Corner⛓ Upon clicking the post shows...
communitygamingchillactivechatting
S
☆ 𝔾ℝ𝕀𝕃𝕃ℤ ☆
1 oylar
Son oy 51w ago
⋆⋅☆ 𝔾ℝ𝕀𝕃𝕃ℤ ☆ ⋅⋆ gaming • active • sfw • icons •
gamingenglishchillactivepfps
R
Ruby nights
1 oylar
Son oy 51w ago
We are a new server ready to provide a fun and Safe community. join to meet new people and make new friends world wide and even look for other gamers
gamingchillactiveegirlssemi tox
C
𓂃  🧸  /Chibuu
1 oylar
Son oy 51w ago
/aura ✧ lf actives ・ boosters need pms ・ mods pfps ・ icons gws ・ semi-active ・ sfw ✧ ||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​|...
friendsfunactivehangoutmake friends
V
🌌 Val's Domain🌌
1 oylar
Son oy 51w ago
This server is open for anyone! From people who like to hangout and chill, to people who want to play games! This server also features private VCs, which allows you to listen to music or just talk to your friends! We also have customisable name colours so you can choose your look. As a growing...
gamingchillactivefortnitevc
O
/onset
1 oylar
Son oy 51w ago
Welcome to Erascord ! What do we offer? Minecraft SMP Roles Levels Activities Welcoming community
activesfwactivitiestaylor swiftswifties
R
Rose Garden
1 oylar
Son oy 52w ago
Our server is for our community of friends who just want to hang out. We can be a little unhinged( just a heads up) but we are very kind are looking for new members. We are usually very active(at least we will be soon enough). There's many things to do and further improvements will be established...
communityfriendsfriendlyactivesupport
D
Desi Robloxians
1 oylar
Son oy 52w ago
Welcome to The Desi Robloxians, we are a Pakistani community with super active channels and members, a place where you can enjoy after a hectic day. We offer friendly environment in this nontoxic community and also offer a lot of fun channels. Join today and have fun with usss!
communityrobloxactivedesipakistani
S
Survival guys🧟
1 oylar
Son oy 52w ago
This is the discord server of the in-game 4 in-game servers called survival Guys inside unturned (free to play on steam) we plan on expanding
activeunturnedfriendly communityunturned free to playsurvival guys
L
⸝⸝ lychee
1 oylar
Son oy 52w ago
ㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤ⸝⸝ noir :  ⟡ㅤㅤㅤ founded ㅤ 10. 17. 2024 ᴗᴗ   active﹒friends﹒matchmaking﹒sfw ㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤ
datinglovefriendsactiveegirls
D
Ditto Xmas Ver.
2 oylar
Son oy 52w ago
ˏˋ°•*⁀➷ Hello! This server is sorta new but members are needed !! (ᴍᴏʀᴇ ᴍᴀʟᴇ ᴍᴇᴍʙᴇʀꜱ ᴀʀᴇ ɴᴇᴇᴅᴇᴅ ᴀꜱ ᴛʜᴇʀᴇ ɪꜱ ᴀɴ ᴏᴠᴇʀᴡʜᴇʟᴍɪɴɢʟʏ ʟᴀʀɢᴇ ʀᴀᴛɪᴏ ᴏꜰ ɢɪʀʟꜱ ᴛᴏ ʙᴏʏꜱ 🌷) ‿୨୧‿︵‿︵‿︵‿୨ᴅɪᴛᴛᴏ୧‿︵‿︵‿୨୧‿︵‿ ᴡʜᴀᴛ ᴡᴇ ᴏꜰꜰᴇʀ ᴛᴏ ʏᴏᴜ... ˏˋ°•*⁀➷ ꜱɪʟʟʏ ᴇᴍᴏᴊɪꜱ ᴀɴᴅ ꜱᴛɪᴄᴋᴇʀꜱ ˏˋ°•*⁀➷ ᴀᴄᴛɪᴠᴇ ᴍᴇᴍʙᴇʀꜱ/ꜱᴛᴀꜰꜰꜱ ᴛᴏ ʙᴇꜰʀɪᴇɴᴅ ᴏʀ ᴛᴀʟᴋ...
loveactivemultifandomsemi toxicdfil
S
𝗥𝗜𝗗𝗘 💞 || 𝗙𝗿𝗶𝗲𝗻𝗱𝘀 & 𝗦𝗼𝗰𝗶𝗮𝗹 𝗦𝗲𝗿𝘃𝗲𝗿 🍸
1 oylar
Son oy 52w ago
Welcome Riders to - RIDE. A friends & Social Server for you to make good connections & bonds. ❤️ • Semi-Toxic Server ❤️‍🔥 • Adult Chat Section 🫦 • Sexy Staff 😋 • Unlimited Fun 🍸 We separate peace talkers & dark chats so our generals are all clean 🤍 Not a gaming server so please keep your...
socialdatingfriendsactivesemi toxic
T
The International Blind Café 18+
1 oylar
Son oy 52w ago
We are a group of blind and visually impaired adults from around the world. We offer a Braille literacy program, kitchen tips and tricks and other resources to inspire independent living. We host a variety of activities such as games, movies, and group discussions to foster camaraderie, good-will...
socialcommunityactiveblindvisually impaired
W
Wisteria SMP
1 oylar
Son oy 52w ago
Welcome to Wisteria SMP, a friendly and inclusive Survival Multi Player server where Minecraft players from both Bedrock and Java editions can come together and build a community. Our server is still in development, but we're excited to grow and evolve with our players. We're committed to creating...
minecraftactivenewsmpminecraft smp
S
🍬𝐎𝐔𝐓𝐄𝐑 𝐁𝐀𝐍𝐊𝐒🎄
1 oylar
Son oy 52w ago
OUTER BANKS Hi! this is a outer banks rp server or just a server where people come together and talk about their theories and other stuff about outer banks! We offer: ╰┈➤Awesome Staff/Members/Owners! ╰┈➤Active Members ╰┈➤Friendly Rp ╰┈➤Aesthetic themes and more!! Join Now!
rpactivenewouter banksobx
F
Fruitbowl
1 oylar
Son oy 52w ago
A very chill server that is almost always active! Join us if you like videogames or just having fun and meeting people!
gamingminecraftrobloxactivedbd
D
domain
1 oylar
Son oy 53w ago
╭━━━━━━━━━━━━━∙☆⋅☆∙━━━━━━━━━━━━━╮ hi ! welcome to domain <3 ☆ we are a fun, welcoming, chill, active 18+ community trying to meet new people & find common interests ! ☆ we offer : active chat active vcs movie nights game nights ☆ come join & meet new friends ! ☆ I hope you enjoy your stay <3
gamingfriendsfunactivehangout
C
Cloud 9ine
1 oylar
Son oy 53w ago
Looking for a server where you can find people to match your energy and make new friends? Look no more! Cloud 9ine is a sfw community with chill and friendly staff. What we offer •friendly staff •gaming vc channels •music channels and bots •find people with the same mental illness as you...
chillactivehangoutpartnershipsmake friends
T
The Chatterbox
1 oylar
Son oy 53w ago
✧ Friendly and Active members ✧ Active Vc's ✧ Nitro giveaways ✧ gifts and premium giveaways ✧ Games and tips ✧ Selfies and Fashion Tips ✧ New friends! ✧ Movie nights!
socialanimechillactivehangout
S
𝕮𝔯𝖎𝔪𝖘𝔬𝖓s 𝔬𝖆𝔰𝖎𝔰
1 oylar
Son oy 53w ago
this is a Chill and Active Community Social almost daily VC, Gaming, a Relaxed Atmosphere Meet New People, fun bots, earn levels and even special roles And more! we may be a small server and we need your help to grow bigger so more people can join our awesome community we hope to see you we do...
gaminglgbtqanimememesactive
S
Servants of the Most High
2 oylar
Son oy 53w ago
A Christian server focused on deliverance, spiritual growth, the gifts of the Spirit, and fulfilling your walk with the Lord. We offer: 🙏 Prayer Meetings 📖 Bible Studies & Teachings ⛓️ Deliverance & Resources 🕊️ Prophetic Events & Gift Development 📻 24/7 Worship Radio ✝️ Only Christian...
activechristianjesusspiritualbible
S
Shiloh’s Home
1 oylar
Son oy 53w ago
︶ ֢ ⏝ ֢ ︶ ୨୧ ︶ ֢ ⏝ ֢ ︶ Shiloh's Home is a community that shelters the outcast active community vcs art channels If you need a place to go to and to make friends, join us in Shiloh's Home!
socialcommunityactivevcsemi toxic
P
Purgatory
1 oylar
Son oy 53w ago
Welcome to Purgatory. 〚 What we Have to Offer: 〛 ♚ Welcoming, tight-knit community ♚ Friend building ♚ Dating ♚ Private room areas ♚ Daily events ♚ Matchmaking (Blind Dates.) ♚ Interactive Mod Team ♚ Safe Spaces ♚ No hate zones ♚ Fun leveling systems ♚ Creative channels We guarantee a lgtbq+...
communitydatingfriendlyactivehangout
N
🐟 • narezushi ;; ♡/revamped
1 oylar
Son oy 53w ago
/dti babes! ૮₍ ˶ᵔ ᵕ ᵔ˶ ₎ა dti ୨୧ frmng ‹𝟹 sfw ꒰ ꒱ྀི events ✿ gwys 𖦹 ranked servers ₊˚ 𓂃˖ 𝜗𝜚 。˚₊. ໒ྀི ₊˚⊹˙✧ join us now!!
communityactivefarmingdtidress to impress
I
Infinite Entry
1 oylar
Son oy 53w ago
4chan community almost no rules just follow discord terms of service discord.gg/zzxb4vUk26 discord.gg/zzxb4vUk26 discord.gg/zzxb4vUk26
socialactiveshitpost4chanesoteric
K
kxesai
1 oylar
Son oy 53w ago
it's just a community. we have a txt channel (you could say whatever you want as long it follows discord tos) media channel (post anything as long it follows discord tos) bots like music honorable mentions we got a vc with a interface also we hope you enjoy this server :D
englishactivehangoutanythingdumb stuff
B
Bianca's pet shop 🩷🐶🐱
1 oylar
Son oy 53w ago
Welcome to my pet shop 🩷 ☆Very active over here ☆ Server is filled with dumb and dumber people. ☆ Rules are more like guidelines ☆ WE ARE NOT A FURRY SERVER
active4chanegirlstoxicsemi toxic
K
/kakaino
1 oylar
Son oy 53w ago
/kokaino™🔓 /// Best server init /// Low moderation + semi toxic Memes and games Active community Selfies and other stuff Voice chats
memeschillactivesfwself promo
T
tragedy™
1 oylar
Son oy 53w ago
𝘁𝗿𝗮𝗴𝗲𝗱𝘆™ ↠ 𝗢𝗙𝗙𝗜𝗖𝗜𝗔𝗟𝗟𝗬 𝗥𝗘𝗩𝗔𝗠𝗣𝗘𝗗 ↞ what we have ↯ ・active nighttime voice chats ・self roles / colors + emotes ・free image perms on join ・low and laid back moderation ╰ welcoming place for everyone
socialactivehangoutvcvalorant
A
A̶G̶O̶N̶Y̶
1 oylar
Son oy 53w ago
we are a small community looking for new members! we are active at times and are welcoming to any new member! join now you rat -beanie
communityclanactivesemi toxicda hood
F
FemHouse
1 oylar
Son oy 53w ago
This is a server that I wanted to make so I have more people to talk too and also too see if there are people that are just like me join if you're looking for friends and people to hang out with we're a decently populated server with plenty of chill and toxic people to talk to 🫶
chillactivesfwfemboylgbq
S
Syko
2 oylar
Son oy 53w ago
JOIN OUR SERVER ,the ultimate hub for gamers! Whether you're a casual player or a competitive pro, you'll find your tribe here. Join us for epic game nights, strategy discussions, and a chill community of gamers who share your passion. From the latest releases to timeless classics, we've got...
gaminganimeactivefortnitechilling
H
hanayoi
1 oylar
Son oy 53w ago
`❀ 、「 Welcome to Hanayoi ! 」 °❀⋆.ೃ࿔*:・..⊹ ❀⊱ Hanayoi is a flower-themed server ❀⊱ It's easy to make friends ❀⊱ Semi-active vc and chat ❀⊱ Weekly streams of community-chosen movies or shows ❀⊱ OW + OW2, Fortnite, DBD, Roblox, and more ❀⊱ Semi-toxic and laidback ❀⊱ SFW ❀⊱ Emotes and...
gaminganimeactivevcsemi toxic
S
selling cnfgs and more
1 oylar
Son oy 53w ago
Best discord server to join we are active alot and chatting everyday hopefully u guys can start conversations and etc join up now!!
socialrobloxactivedahoodstox
N
N.E.D| Dating and Drama
1 oylar
Son oy 53w ago
Active community with lots of toxic people. We got the racists, fatphobics, transphobics, autistics, trannies, mod abusers, e-girls, plenty of e-whores (aka hyper, ariaa, becca [a "changed girl" who has not changed a single bit], pri etc), gamers, anime weaboos, YOU NAMEEE IT!!! We got a top notch...
communityfunfriendlychillactive
M
Made in Heaven
1 oylar
Son oy 54w ago
Welcome to our server made in heaven! we're a friendly group where we chill have fun and meet new people. you also have the chance of meeting people you like and get along with and more! Join us and be a part of our group where you will have the best time of your life!! p.s if you dont join then...
socialfriendsactivehangoutvc
S
۶ৎ 𝚂𝚎𝚛𝚎𝚗𝚒𝚝𝚢 𝙼𝚎𝚊𝚍𝚘𝚠𝚜 🌷
4 oylar
Son oy 54w ago
🌻 Welcome to serenity Meadows! This server is a for people who want to make friends, find a relationship, or just hang and chill around.🌻 🌙 What we offer: Tons of channels Cute server layout Emojis Friendly Staff team safe space and mandatory self roles!
datinglgbtqcommunityactivevc
M
Mature 18+
1 oylar
Son oy 54w ago
Tired of joining servers full of whinning kids? Here is the place to have a relaxed conversation with other mature individuals https://discord.gg/yxT8exQQvK
maturecommunitysocialactivegaming
S
Sleepaways
1 oylar
Son oy 54w ago
︎ʚ sleepaways ɞ what we offer ❄️ Meet new people! Age friendly! Lgbtq friendly! Fandom friendly! Non toxic! Chill! Nsfw & sfw channels! Christmas theme, many channels & emojis!! Nice & funny members + mods. Semi active!! We would love to meet you!! and have you as a lovely member
communityactivelgbtq friendlyage friendlychristmas
S
🔮・𝙂𝙡𝙤𝙗𝙖𝙡𝙑𝙞𝙗𝙚 𝘾𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮™
1 oylar
Son oy 54w ago
➔ 🔮・𝙂𝙡𝙤𝙗𝙖𝙡𝙑𝙞𝙗𝙚 𝘾𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮™ ┳━╍━╍━╍━╍━╍━╍━╍━╍━┳ Osnovne stvari o serveru: Server osnovan 20.10.2023, server je napravljen u cilju zabave druzenja i igranja igrica i slusanje muzike. ━╍━╍━╍━╍━╍━╍━╍━╍━ Nesto osnovno o serveru! ・Chill & Gaming Community. ・Kanali sredjeni u...
communitygamingchatactivegiveways
A
Allow™ 📲❄
2 oylar
Son oy 54w ago
Welcome to /allow, a haven for those seeking an extraordinary online community experience. Immerse yourself in a world where camaraderie thrives, daily giveaways sparkle, and an extensive library of over 500 emotes awaits your exploration. Why should you join? /allow transcends the conventional...
communityactivegiveawaynitroegirl
J
James’s Hangout
1 oylar
Son oy 54w ago
Welcome to James’s Hangout! Are you looking for a Thriving, Active, Chilled Community? Well this server is for you!! We Offer: ✨- Friendly members to interact with:) 🛠️ - Helpful & Active staff to assist you! 🔒- SFW (No nsfw) 🎉 - Giveaway with prizes such as nitro, roles etc… 🤖 - Fun bots to...
communitygiveawaysactivechitchatfun bots
P
peachy's treehouse !! 🌷 𓈒 ˖
1 oylar
Son oy 54w ago
hai !! ˃ᗜ˂ looking for a new and friendly community? you are at the right place! ﹒sfw and friendly community! (kinda active) ﹒aesthetic server ! ﹒currently looking for staff and pms ! ˘ᗜ˘ please join and we hope u enjoy your stay <3 !
friendlychillactivepartnershipsvc
...
Discordfy Logo

Discord sunucularını keşfetmek ve tanıtmak için en iyi platform. Binlerce topluluğa katılın ve aynı ilgi alanlarına sahip insanları bulun.

En iyi sunucular

  • Oyun sunucuları
  • Anime sunucuları
  • Minecraft sunucuları
  • Sosyal sunucular

Kaynaklar

  • Sunucu ekle
  • Premium
  • Blog
  • Destek

Yasal

  • Hizmet şartları
  • Gizlilik politikası
  • Kurallar

© 2025 Discordfy. Tüm hakları saklıdır.

Discordfy.com Discord ile bağlantılı değildir.

Discordfy means Discord for you :D