Ana sayfaya dön
Top Ranking

Roleplay Servers

Discover the best roleplay servers on Discord

3424 sunucular
Updated every 6 hours
T
Touhou: Return to Equilibrium
0 oylar
Another Touhou RP server? ON DISCORD!? If you're looking for a more advanced Touhou roleplay with a focus on quality and consistency, this may be the place for you. This server is intended to be far less casual than what has become the norm on Discord. We take the lore seriously, and as such there...
roleplayrptouhoutouhou roleplaytouhou rp
M
Moon’s Blight
0 oylar
˚•̩̩͙✩•̩̩͙˚*  Moon's Blight   ˚•̩̩͙✩•̩̩͙˚*  # Disclaimer: You must be 15+ years old in order to join because of the dark themes within this server. Moon's blight is a fan-clan system that is based on Erin Hunter's beloved series, Warriors. Moon's blight carries four unique clans within its...
roleplayrpwarrior catswarriorswarriorsrp
H
Halo: Hunt The Truth
0 oylar
Set in the early 2550s, a vicious conflict over the Outer Colonies continues on. The UNSC finally realizes they may lose the war, and with the Fall of Reach two years on the horizon, mothball fleets of assault carriers and dreadnoughts are the only thing preventing the front line from...
roleplayrphalohalo rp
T
The Sanctuary™
0 oylar
🐲 Welcome to our Pokemon Mystery Dungeon server, where the Totem Kommo-o has established a sanctuary with an aim to offer a thriving RP scene for a world filled with Pokemon and to form a community of Pokemon Artists and fans alike! Our Server Has: ◘ 📋 A simple verification system ◘ 🔝...
roleplayrppokemonpokemon roleplaypokemon mystery dungeon
M
=͟͟͞➳❥ MOBANSH: New era
0 oylar
:¨·.·¨: `·. ➷__ °. ☁️ ┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈┈ ° • Somos un servidor de mundo abierto, contamos con varios canales de exploración y relajación, ambientes donde puedes rolear distintas temáticas sin necesidad de estar ligadas al lore principal del servidor, nuestro propósito es brindarles un mundo...
roleplaymedievalfantasiaroleplay espanolcontemporaneo
T
The Happy Hotel || RP Server 18+
0 oylar
✦ ————————— ✦ 𝒲𝑒𝓁𝓁, 𝒽𝑒𝓁𝓁𝑜 𝓉𝒽𝑒𝓇𝑒 𝓎𝑜𝓊 𝓌𝒶𝓎𝓌𝒶𝓇𝒹 𝓈𝒾𝓃𝓃𝑒𝓇! 𝒟𝑜 𝓎𝑜𝓊 𝓁𝒾𝓀𝑒 𝓇𝑜𝓁𝑒𝓅𝓁𝒶𝓎𝒾𝓃𝑔, 𝒽𝒶𝓋𝒾𝓃𝑔 𝒻𝓊𝓃 𝒶𝓃𝒹 𝓂𝒶𝓀𝒾𝓃𝑔 𝒻𝓇𝒾𝑒𝓃𝒹𝓈!? 𝒪𝒻 𝒸𝑜𝓊𝓇𝓈𝑒 𝓎𝑜𝓊 𝒹𝑜 𝓌𝒽𝓎 𝑒𝓁𝓈𝑒 𝓌𝑜𝓊𝓁𝒹 𝓎𝑜𝓊 𝒷𝑒 𝓇𝑒𝒶𝒹𝒾𝓃𝑔 𝓉𝒽𝒾𝓈...
roleplayocshazbin hotelhelluva bosshelluverse
C
COLOR CLASH S3 [SIGN UPS OPEN]
0 oylar
————————————————— Color clash is a joke camp, where some colors compete to see which is the best color of all time. Every color has their own different physical characteristics, some making challenges easier or harder. Will you join this competition and prove that your favourite color is the best...
roleplayobject campobjectobject showosc
S
Sonic Exodus
0 oylar
Welcome, Dear Guest *You’ve arrived to my domain. A mere expanse in a great void I have shaped as best as I could with what power I have. You're a mere speck inside of this void..but do not think your worthless and pathetic. No…your more. Why else why would I invite you here? Who am I? A mere...
rpsonicmultiversesonic the hedgehogsonic rp
S
◞ 𝕰𝖙𝖊𝖗𝖓𝖆𝖑 𝕾𝖔𝖑𝖎𝖙𝖚𝖉𝖊 𝕮𝖑𝖎𝖓𝖎𝖈 ⸝⸝
0 oylar
+. ʚଓ : 【 YOU'RE WELCOME :D 】₊ ✧୨୧‿︵ ┈✦┈✦┈✦┈✦┈ Hello, patient ! Welcome to the Eternal Solitude Clinic. Here, we offer friendly staff / members and honestly a chaotic but safe environment !! We DO have a verification system, though it's VERY easy to fill out. It's for the safety of the living...
roleplayrprole playfantasy rpclinic rp
S
server
0 oylar
► THE MANSION (Based on the popular fanon) In the heart of the forest, in a tiny pocket dimension, a decrepit mansion sits. With four floors and the entire forest to explore, how can anyone get bored? Just be careful, the higher you go the more dangerous it becomes… The dark and constantly cold...
roleplaycreepypastaoc roleplaycreepypasta roleplaycreepypasta ocs
T
The Campfire 20+
0 oylar
A server for grown-ass adults. Ages 20+ only. Are you an adult with adult responsibilities, a job, a family, or just simply don't have the free time you used to? Despite all that, do you still love to roleplay, but are sick of being left in the dust by teenagers with nothing better to do? Welcome...
roleplaydcmarvel rp1v1panfandom rp
T
The A.L. Project
0 oylar
⚠️ THIS IS AN 18+ SERVER ⚠️ ————————————————————— You awaken... Your whole body hurts and you can't seem to stand that well but you do so anyway. You have no recollection of where you're at or who you are but it would seem you're in some sort of..hub? The place seems to have long since been...
roleplayfantasymedievalerpisekai
T
✧.* 🌊 The Future 🌊 ✧.*
0 oylar
Welcome to ✨ The Future ✨ ! A 15+ Steven Universe Roleplay server that takes place after the original series and before the movie. This server offers the choice of claiming Cannon Characters as well as creating OC's- yes, even HYBRID oc's... slots are minimal, so hurry over fast! This server also...
roleplayrporiginal characterssteven universesteven universe rp
S
𝐓𝐇𝐄 𝐍𝐄𝐖 𝐅𝐑𝐎𝐍𝐓𝐈𝐄𝐑 𝐑𝐎𝐋𝐄𝐏𝐋𝐀𝐘 [𝐍𝐅𝐑] 𐂂
0 oylar
Are you wanting a server like redm but for PS4 & PS5 players!! Look no further! We are RED DEAD REDEMPTION 2 ROLEPLAY WILD WEST RP!
gamingroleplayps4red dead redemptionps5
A
Apocryphal
0 oylar
Come role play with us! Very lenient on oc rules and abilities! ~ ~Welcome to Little Fork, nestled in the heart of Pennsylvania, a seemingly ordinary small town with charming streets and historic buildings. For generations, rumors have whispered of extraordinary happenings, where the ordinary hides...
roleplayrpwerewolfvampiretvd
C
CITY OF STAR ☆ 💮
0 oylar
🌺 Um RPG de magia e mistério que se passa em uma cidade remota e vários desafios a sua espera para serem desvendados ✧nota do Dono⁠✧ 🌺 O Rpg e novo e logo terá mais novidades com o passar do tempo , e com sugestões de vocês ficará melhor, agradeço se entrarem
socialcommunityroleplayrprpg
J
Jujutsu Kaisen College AU [+18]
0 oylar
Server currently revamped ! Many popular characters available as of 21 June : Inumaki, Kirara, Hakari, Nanami, Mai, Todo, Mimiko, Junpei, Kashimo.. and many more ! jjk [Jujutsu Kaisen] AU! This is not derived from anything canon and your characters may be whoever they wish to be! The main focus...
animeroleplaycollege aujjkjjk rp
T
The Minds
0 oylar
Hey there! This is a brand-new server! The server was officially finished a few days ago! Please don't expect much; we don't have many members, and some things may be in the works. Now, let's move on to the introduction of the server! This is a Criminal Minds based server where you talk all about...
roleplayfandomtv showcriminal mindscm
C
🦴 candlelit   ⁀ ⁀
0 oylar
welcome  ⁺  trailblazer !  𓈒  ℐ ㅤ𓏏𓏏 ⠀ ₊ ⠀⠀⠀this is a sfw school au rp server ! no au channels soon ! ㅤ  ㅤ𓏵 ⠀⠀ocs welcome,ㅤㅤ⠀ 。⠀⠀ㅤㅤrare pairs welcome  𐔌⠀⠀⠀ ⠀𓈒⠀⠀⠀friendly !  ◞ ྀི ⠀𓏴⠀⠀⠀⠀⠀cute emojis .and way more !
animeroleplayrphsrhonkaistarrail
S
⋆꒷꒦‧₊˚ 𓆩 ꁅꍏꌩ ꀸꍏꌩ ꀤꈤ ꃅꍟ꒒꒒ 𓆪 ˚₊‧꒦꒷⋆
0 oylar
.・。.・゜✭・.・✫・゜・。. .・。.・     a HH & HB rp server ✦    ❛    ➼    ⸝⸝ ⟢ ﹒ 𝗪𝗛𝗔𝗧 𝗪𝗘 𝗢𝗙𝗙𝗘𝗥 ntox . sfw . social . semi-lit / literate . radioapple safe place . 15+ ⌣⌣    ⸝⸝    。    ✦  ﹒ SLICE OF LIFE AND DRAMA ⤷ 𝗟𝗚𝗕𝗧𝗤 𝗢𝗪𝗡𝗘𝗗
roleplayhazbin hotelhelluva bossradioapple
B
Burning Lotus ~ ༊*·˚
0 oylar
Hello! Welcome to Burning Lotus! We are a roleplay server with a fantasy theme as well as extensive lore. We have friendly and active staff as well as an open door, no hate policy! We are 13+ as per discords TOS Our server includes Lore Very few limits on OCS Reasonable rules and ones in place...
roleplayrpfantasyocsystem friendly
S
𝑾𝒉𝒊𝒔𝒑𝒆𝒓𝒔 𝑶𝒇 𝑻𝒉𝒆 𝑭𝒂𝒆
0 oylar
In a world of wonder and fantasy, fae rule the world, humans nothing but worthless slaves, born to serve, slaughtered for entertainment But this doesn't last long... no. No fae who disagree with this treatment began speaking up, banning together, until a war broke out, fae fighting at the humans...
roleplayrpfantasymagicfae
U
Ur Amel: A Dark Fantasy RP
0 oylar
The year is 431 of the Fourth Age. Four centuries have passed since the great Elvish Empire collapsed, and since then Kingdoms and Empires have risen from the ashes. Yet not all traces of the old empire have been lost. Ur Amel, the former capital of the Empire remains, its treasures left unclaimed....
roleplayfantasyrpgfantasy rpdark fantasy
M
MHA: A New Generation of Heroes
0 oylar
Everyone is older now and has kids of their own. Some heroes have retired and new heroes have replaced them. You would think that UA is safe now... but the league has gotten together once they found out that Izuku's child has started school and inherited one for all. What happens next? Can the...
roleplayrpmhamha rp2nd gen
S
𝐀𝐒𝐇𝐄𝐒 𝐎𝐅 𝐇𝐔𝐌𝐀𝐍𝐈𝐓𝐘
0 oylar
𝐀𝐒𝐇𝐄𝐒 𝐎𝐅 𝐇𝐔𝐌𝐀𝐍𝐈𝐓𝐘 "𝒜𝓂𝑜𝓃𝑔 𝓉𝒽𝑒 𝒜𝓈𝒽𝑒𝓈, 𝐻𝑜𝓅𝑒 𝐹𝒾𝓃𝒹𝓈 𝒶 𝒲𝒶𝓎" 𝐃𝐄𝐒𝐂𝐑𝐈𝐏𝐓𝐈𝐎𝐍 In the following of unprecedented epidemic in the year 2016, the world was forever altered by the discovery of an ancient disease frozen in time within the ice-encased body...
roleplaypost apocalypsezombie apocalypsezombie rpzombie survival
W
west wind :: a death game
0 oylar
A number of people mysteriously disappeared. More and more seem to go missing, all from the same city. Over the course of 2 weeks, these people had been picked away from their jobs, schools, houses, disappearing completely. There are no leads on who, or what could haven taken these victims. West...
roleplay16deathgamedgrp
E
Ember Forge
0 oylar
Ember Forge ,,,,,,,,,,,,,,,,,,,,,,, >> Kami menyediakan berbagai fasilitas yang menarik, seperti: 💬,Komunitas berbagai obrolan untuk bahasa indonesia-english. 🤖,Terdapat berbagai bot yang dapat menghilangkan rasa bosan seperti: OwO, Pokètwo, Sofi, Mudae, Karuta, dan lainnya. 🎁,Akan ada...
gamingroleplayartrandomindonesia
D
Dragon Ball X: The New Gods
0 oylar
┏━━━━━━༻༺━━━━━━┓ 𝘊𝘰𝘮𝘦 𝘰𝘯𝘦! 𝘊𝘰𝘮𝘦 𝘢𝘭𝘭! 𝘛𝘰 𝘢 𝘣𝘳𝘢𝘯𝘥 𝘯𝘦𝘸 𝘢𝘥𝘷𝘦𝘯𝘵𝘶𝘳𝘦.. ⚘𝐃͟𝐫͟𝐚͟𝐠͟𝐨͟𝐧͟ ͟𝐁͟𝐚͟𝐥͟𝐥͟ ͟𝐗͟:͟ ͟𝐓͟𝐡͟𝐞͟ ͟𝐍͟𝐞͟𝐰͟ ͟𝐆͟𝐨͟𝐝͟𝐬͟ ⚘ 𝘏𝘦𝘺 𝘵𝘩𝘦𝘳𝘦! 𝘈𝘳𝘦 𝘺𝘰𝘶 𝘭𝘰𝘰𝘬𝘪𝘯𝘨 𝘧𝘰𝘳 𝘢 𝘯𝘦𝘸 𝘢𝘥𝘷𝘦𝘯𝘵𝘶𝘳𝘦? 𝘔𝘢𝘴𝘴𝘪𝘷𝘦 𝘢𝘮𝘰𝘶𝘯𝘵𝘴...
roleplayrpdbzdragonballdragonball oc
S
ℙ𝕒𝕟𝕖𝕞 𝕋𝕠𝕕𝕒𝕪, 𝕋𝕠𝕞𝕠𝕣𝕣𝕠𝕨, 𝔸𝕝𝕨𝕒𝕪𝕤
0 oylar
ℙ𝕒𝕟𝕖𝕞 𝕋𝕠𝕕𝕒𝕪, 𝕋𝕠𝕞𝕠𝕣𝕣𝕠𝕨, 𝕒𝕟𝕕 𝔸𝕝𝕨𝕒𝕪𝕤: Panem. A country defined not only by its times of peace, but for its savage responses to any sort of rebellion. It has been 200 years since Katniss Everdeen won her first games, and Panem is now back to exactly the way it was before The...
roleplaythe hunger gameshunger gameshunger games roleplay
S
Social City
0 oylar
Social City RP Там където историите стават реалност... Ела и изживей своята история... Очакваме ви!
gamingroleplayrpgtavbulgaria
S
SuperCity
0 oylar
🌟 Unleash Your Inner Superhuman 🌟 Step into a world where hidden potential awaits, where the boundaries of reality blur, and extraordinary abilities become your birthright. Join our immersive roleplay server, where the plot is as captivating as the characters you'll create. 🛸 A Strange...
roleplayrpsuperheroscity rpsuperhero rp
C
αctívє gσrєαn rσlєplαч
0 oylar
•❅───✧❅Active Gorean Roleplay ❅✧───❅• ✦ We are a 21+ server, verifying age may be requested ✦ I looked over the roofs of Corcyrus. I could see, among trees, the various theaters, and the stadium. I could see the palace from where we stood. I could see, too, some of the gardens and the roof of the...
roleplaymasterkajiragorgorean
W
Wentworth Academy: The Tradition of Excellence
0 oylar
“I’M NOT LYING, I SWEAR I SAW SOMETHING!” Wentworth Academy is an interactive mystery storyline to investigate, and a diverse cast of characters to interact and team up with. You are attending a boarding school in Bromley, Vermont— a sleepy red-brick trail town in the Appalachian...
roleplayrpschool rpmysteryparanormal
R
Re:Zero -New Horizons-
0 oylar
══✧〖ℝ𝕖:ℤ𝕖𝕣𝕠 --ℕ𝔼𝕎 ℍ𝕆ℝ𝕀ℤ𝕆ℕ𝕊--〗✧══ ║ 𝐖𝐞𝐥𝐜𝐨𝐦𝐞 𝐭𝐨 𝐑𝐞:𝐙𝐞𝐫𝐨 "𝐍𝐞𝐰 𝐇𝐨𝐫𝐢𝐳𝐨𝐧𝐬!" ║ ┝✽ 𝘞𝘪𝘵𝘩 𝘢 𝘵𝘸𝘪𝘴𝘵 𝘰𝘧 𝘙𝘦:𝘡𝘦𝘳𝘰'𝘴 𝘴𝘵𝘰𝘳𝘺𝘭𝘪𝘯𝘦, 𝘵𝘩𝘦 𝘮𝘪𝘭𝘪𝘵𝘢𝘳𝘺 𝘤𝘢𝘮𝘱𝘢𝘪𝘨𝘯 𝘢𝘨𝘢𝘪𝘯𝘴𝘵 𝘵𝘩𝘦 𝘞𝘩𝘪𝘵𝘦 𝘞𝘩𝘢𝘭𝘦 𝘸𝘢𝘴 𝘢 𝘴𝘶𝘤𝘤𝘦𝘴𝘴 𝘢𝘯𝘥...
communityroleplayaure zerorezero
S
ʕ⇜𝒯𝒽𝑒 𝑀𝑒𝒶𝒹𝑜𝓌⇝ʔ
0 oylar
ʕ⇜𝕋𝕙𝕖 𝕄𝕖𝕒𝕕𝕠𝕨⇝ʔ╏ ⊹ You Get To Make Custom Species With Abilities & Magic 🧚 ⊹ An Assortment Of Areas To Explore, Live And Thrive 🗺️ ⊹ It's A Free Roleplay So You Can Do Anything- Abiding By Rules- Anytime! 🕑 ⊹ Special Events To Uncover And Explore The Mysteries Of The Meadow server is...
roleplayrpfantasyfantasy rpmagic
T
The Union Pacific of 2020
0 oylar
The year is 2018, Union Pacific is the premier freight solution. Connecting our nation’s cities, businesses, and supply chains. Thousands of Union Pacific trains roam the rails every day, dominating the market. They go to places such as California , Nebraska, Illinois, and Oregon. Although Union...
lgbtroleplaytrainsthomasunion pacific
R
RP Partner Finder
0 oylar
Hello! The intent of this server is to help people find partners for either 1x1 or small group rps! Keep in mind that this server is not meant to be rped in, persay. Just to find people to rp with. Roleplay channels might be added in the future though if demand is high!
roleplayrp13oc rprp finder
C
Cyberpunk 2077: Perpetual Requiem
0 oylar
Perpetual Requiem - never-ending funeral. Welcome to Night City! While most people come to the city to make it big, they often stay in it in a body bag. Even with the Corpo espionage and secret dealings, the gangs trying to carve out even larger turfs and battling each other - many consider the...
roleplayrpcyberpunkcyberpunk 2077cyberpunk rp
M
MulaCity - Roleplay
0 oylar
Beste FiveM spelers, Zoeken jullie nog een leuke actieve en gezellige stad! Neem dan zeker een kijkje bij ons in Mulacity. We zijn zeker nog opzoek naar overheidsmedewerkers dus je zou gewoon kunnen solliciteren! Ook voor de onderwereld is er genoeg te doen je kan het initiatief nemen om je...
roleplaygtadutchfivemmulacity
A
Avengers Server
0 oylar
Welcome to Avengers AU We're a server set within an Avenger AU, and the plot is entirely in your hands. Our focus is allowing people to write au's for canon characters or , so long as they don't disrupt (or perhaps they simply re-explain) the mcu timeline as we know it. here's some of what we...
rpmarvelavengers
H
꒰ HERO HAVEN ꒱   ★  ᡴꪫ
0 oylar
꒰ ᡴꪫ HELLO! welcome to ꒰ HERO HAVEN ꒱   ★  13-18 ᡴꪫ  ★ LGBTQ+ SAFE! ᡴꪫ ★ we are a MHA roleplay community, if you’ve watched MHA join us!! we follow the plot line of the series! the lore will start off of S5 and will continue on! we have lots of open characters you can choose from!! and we are...
communityanimeroleplaymhamyheroacademia
S
𝙝𝙞𝙧𝙖𝙚𝙩𝙝 . . .
0 oylar
── ◜✧◞ HIRAETH ! ﹕ᶻz a Welsh word meaning nostalgia for a home you’ve never been too. hello! we are a sandbox server, with no set timeline and everyone’s alive (woohoo)! we expect everyone to be above the age of 13, and able to write at least a paragraph per response. WHAT DO WE OFFER ? ⤹﹒Staff...
animeroleplayrpbnhamha
A
Astriea Academy
0 oylar
Come join us at Astriea Academy, a Royale High roleplay server! Create ocs, participate in roleplays, and interact with others! We hope to see you enrolled 🕰️
roleplayrobloxroyale highroyale high roleplay
V
Veritas [18+ SFW]
0 oylar
Step into Veritas-- a vast underground city beckoning to those brave enough to explore its depths. Centuries ago, humanity fled underground in the aftermath of the Gods' devastating downfall. Their blood corroded the lands and left horrors in its wake. With the passing of time the surface has...
roleplayrpfantasyliteratesteampunk
I
Intrusive RP
0 oylar
RedLine District Rp is a car enthusiast based rp server. We just recently opened to the public 5/23/24 come in and check it out you will not be disappointed. Our focus is providing a peaceful non toxic environment to enjoy. Our server is a laid back rp server where you can just do your jobs to...
roleplayracingfivemboostingdrifting
...
...
Discordfy Logo

Discord sunucularını keşfetmek ve tanıtmak için en iyi platform. Binlerce topluluğa katılın ve aynı ilgi alanlarına sahip insanları bulun.

En iyi sunucular

  • Oyun sunucuları
  • Anime sunucuları
  • Minecraft sunucuları
  • Sosyal sunucular

Kaynaklar

  • Sunucu ekle
  • Premium
  • Blog
  • Destek

Yasal

  • Hizmet şartları
  • Gizlilik politikası
  • Kurallar

© 2025 Discordfy. Tüm hakları saklıdır.

Discordfy.com Discord ile bağlantılı değildir.

Discordfy means Discord for you :D