Вернуться домой

Discord серверы Chill

Откройте для себя лучшие Discord серверы в категории chill

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
S
༺supernova༻
0 голосов
come meet the egirls who love gaming, talking, and more! 😸 (ages 16+) •fortnite •among us •cards against humanity •uno •voice chat
socialcommunitygamingchillegirls
P
¡POP! City
0 голосов
✧・゚: ✧・゚::・゚✧:・゚✧ ✧・゚:✧・゚::・゚✧:・゚✧✧・゚: ✧・゚:・゚✧:・゚✧✧・゚:✧・:・゚✧:・゚✧✧・゚: ✧・゚✧:・゚✧✧・゚: ✧:・゚✧:・゚✧ ¡POP! City es un servidor muy nuevo que busca gente para hablar, platicar, y pasársela bien y tranquilos, se puede hablar de todo tipo de temas acá y demás. Puede que tengamos un humor bastante fuerte, por...
chillmusicaanime mangavideojuegoscharlar
E
Eli's Kingdom
0 голосов
welcome to elis freak kingdom🗣️🗣️ where we know how to run servers and be nice! This is a new server made by two idiots, so join at your own risk If you wanna get the owners attention, make sure to like: Football Steelers Lucki and sky pics Anything less than that and you will be banned. (just...
chill13steelerslucki
B
🔥🐣<||> Blue Napalm County
0 голосов
Hola, somos un servidor pequeño enfocado en el apartado social y ambientado en un pequeño condado. Nos esforzamos para darle una bonita experiencia a los ciudadanos con bots variados, canales con temáticas, administración eficiente y cosas por venir 🐢👷
socialgamingchillhangoutmeetandgreet
M
Mochos City
0 голосов
𝗕𝘂𝗲𝗻𝗮𝘀, 𝗠𝗼𝗰𝗵𝗼𝘀 𝗖𝗶𝘁𝘆 𝗲𝘀 𝘂𝗻 𝘀𝗲𝗿𝘃𝗶𝗱𝗼𝗿 𝗽𝗮𝗿𝗮 𝗰𝗼𝗻𝗼𝗰𝗲𝗿 𝗴𝗲𝗻𝘁𝗲 𝗽𝗮𝗿𝗮 𝘀𝗼𝗰𝗶𝗮𝗹𝗶𝘇𝗮𝗿 𝗼 𝗷𝘂𝗴𝗮𝗿, 𝘁𝗮𝗺𝗯𝗶𝗲𝗻 𝗲𝘀 𝗽𝗮𝗿𝗮 𝗵𝗮𝗰𝗲𝗿 𝗮𝗰𝘁𝗶𝘃𝗶𝗱𝗮𝗱𝗲𝘀 𝘆 𝗽𝗮𝗿𝘁𝗶𝗰𝗶𝗽𝗮𝗿 𝗲𝗻 𝗲𝘃𝗲𝗻𝘁𝗼𝘀.𝗢𝗳𝗿𝗲𝗰𝗲𝗺𝗼𝘀 𝗺𝘂𝗰𝗵𝗼 𝗺𝗮𝘀,...
socialchillcomunidadespanolalianzas
B
Beef Family
0 голосов
We are a fun loving small community that all met through clash of clans. We are always looking for new people to chat and play with.
communitygamingchillclash of clans
A
Ace’s server
0 голосов
Sure! Here's a chill description for your Discord server: "Welcome to [Server Name] – a laid-back community where you can kick back, relax, and vibe with good company. Whether you’re here to chat, game, or share cool stuff, this is your cozy corner on the internet. No drama, just good vibes and...
animechillmulti fandomred dead redemption 2ufc
S
𝐒𝐏𝐈𝐃𝐄𝐗 | • 𝐘𝐓 • 𝐟𝐫𝐢𝐞𝐧𝐝 • 𝐜𝐡𝐢𝐥𝐥 • 𝐠𝐰𝐲𝐬 °
0 голосов
🎮 Welcome to SPIDEX! 🎶 Are you ready to level up your gaming experience and groove to the rhythm of epic tunes? Join The Gaming Soundscape, the ultimate Discord server where gaming enthusiasts and music lovers unite! 🌟 🔊 What We Offer: 🎧 Epic Soundtracks & Playlists: Dive into curated music...
musicchillinternationalgammingyoutube community
A
Anime Ambience
0 голосов
Welcome to Anime Ambience! 🌸✨ Your ultimate destination for unwinding with fellow anime enthusiasts. Dive into a world where the latest anime episodes, manga chapters, and soundtracks come alive. Whether you’re here to share your favorite series, discuss hidden plot twists, or just enjoy the...
animemusicgamechillmanga
1
𝓢𝓽𝓪𝓻𝓼𝓽𝓻𝓾𝓬𝓴 𝓢𝓸𝓾𝓵𝓼 +18 𝓢𝓕𝓦
0 голосов
𝓢𝓽𝓪𝓻𝓼𝓽𝓻𝓾𝓬𝓴 𝓢𝓸𝓾𝓵𝓼 +18⊰ 𝓢𝓦𝓕 HANGOUT! GAMING! ACTIVE VC'S! DATING ! ------------- ------ ------------- ---------- WELCOME TO STARSTRUCK SOULS +18 What We Offer! ✭ Active Server This Place is Poppin! ✭ We have a Minecraft server! ✭ Server dating locked behind I.D verification ✭...
gamingdatingmemeschillhangout
1
1984
0 голосов
be yourself............................................................ (16+) don't join if you are sensitive.. (please) join if you wanna have fun and make friendz We love Deathcore/Black metal/Thugs Female owned
chillemosmallalttoxic
H
Hoshino's Resort
0 голосов
Hoshino's Resort gives you a chill vibe as we enjoy cute and funny arts. This community server can have anything you want on a server as any person can be a member and could fit well (if they know how to make conversations ofc). It is indeed a unique server where everyone can just chill and have...
minecraftanimechillcuteblue archive
G
Graveyard Soul
0 голосов
࣪ ִֶָ☾. Geaveyard Soul ࣪ ִֶָ☾. Welcome to Graveyard Soul, an english social server where you can meet new people and have fun chatting or playing. . ݁₊ ⊹ . ݁˖ . ݁ Server . ݁₊ ⊹ . ݁˖ . ݁ 𑁍ࠬܓ Bots ~ We have a lot of bots for you to have fun and for those who like daily claims. ~ 𑁍ࠬܓ Channels ~...
socialcommunityenglishchillother languages
A
Aspen & Rogue Zone
0 голосов
cool server, cool people, still a new ish server but still awesome so lets goooooooooooooooooooooooooooooooooooooooooo
gamingfriendlychilllgbtqpog
B
✟BHOOT BANGLA✟
0 голосов
👻 Welcome to Bhoot Bangla 👻 Enter the haunted realm of Bhoot Bangla, where spooky vibes meet endless fun! 🎃 Whether you're into horror stories, gaming, movie nights, or just want to chill with a paranormal twist, we've got something for everyone! 🌕💀 🌟 What we offer: 🕯️ Active & welcoming...
chatchillhorrorspookyghost
T
🎃 The Gamer Lounge 🎃
0 голосов
(THIS IS NOT A DATING SERVER, KEEP THAT IN DMs) (THIS IS NOT A DATING SERVER, KEEP THAT IN DMs) (THIS IS NOT A DATING SERVER, KEEP THAT IN DMs) The Gamer Lounge We are just a chill all around community server, we have multiple Voice Channels for multiple reasonably! We have a very cool community...
communitygamingfriendlychillnon dating
C
Celestial Realm 🥟 soc 。 nitro
0 голосов
Hey there! Are you an anime enthusiast looking for a cozy corner of the internet to kick back, relax, and geek out over your favorite shows? Look no further! Welcome to Celestial-Realm - the ultimate haven for anime lovers and chill vibes. Step into a world where the latest anime releases, classic...
animefriendschillgiveawaysnitro
T
The Hidden Grove
0 голосов
Welcome to The Hidden Grove! 🌿 Our brand-new community is open to everyone looking for a friendly place to chat, make friends, and relax. The Hidden Grove is all about creating a safe and positive space where everyone can feel at home. We encourage open communication, kindness, and respect for...
communitygamingfriendlychill
D
✧ Degenerates | 16+ 🎃
0 голосов
join and we'll bake you a cake!! jk, we're looking for 16+ users, toxic, semi toxic, weak, anything. Come and hangout with us pls - and we'll accept you for who you are (maybe) join or you're gay. egirls hangout games toxic, semi toxic giveaways emojis halloween
gaminganimechille girlssemi toxic
T
The Crackhead Gaming Hub
0 голосов
A newly started server for people to ●hangout ●play games ●post memes for each other. Dark humor is allowed. Come join us.
gaminganimechilldark humor
D
Doge&Waffles Hangout
0 голосов
Freshly new and chill server with nice enough people. Still in the process of being constructed.
funnychillsemi active
S
seoul station
0 голосов
🧋 - ͙۪۪˚┊❛Tokyo Station!❜┊˚ ͙۪۪◌ 💌 Anime, Kpop, Gaming conversations! 🏷️ An aesthetic layout! 🍡 Cool members to hangout with B) 🍰 Hosting giveaways, events; open partnerships! 🎐 A cat kiss from the owners for new members! ︶꒷꒦︶︶꒦︶꒷︶︶꒦꒷︶︶︶꒷꒦ ‧₊ ⸝⸝ we hope to see you soon, thanks for reading!...
socialchillactivegiveawayaesthetic
S
𓏲 ࣪₊♡𓂃 𝚘 𝚗 𝚒 𝚛 𝚒 𝚚 𝚞 𝚎 . ˚◞♡
0 голосов
ᵕ୨★ vote for a new server theme every 1-2 months! (mostly animanga) ᵕ୨★ server for making new friends + meeting new people with similar interests ᵕ୨★ rules aren't that strict, feel free to yap about anything ᵕ୨★ everyone is welcome!!! any age, race, gender etc. ᵕ୨★ we try to be active, just say...
animefriendschillmangahangout
V
Vibez
0 голосов
🌸˚₊‧꒰ა step into vibez ໒꒱ ‧₊˚ 🌸 at vibez, we’re a friendly and sfw community, with active members always up for a good chat. We’re looking for new faces—so come vibe with us! ₊˚⊹ ᰔ. 🍡 come chill and make new friends! 🧸 fun bots to interact with, plus games! 💌 partnerships available! 🦢 server...
socialgamingfriendschillhangout
N
Nuggie's Cafe ⸜(。˃ ᵕ ˂ )⸝♡
0 голосов
Hello There! (15+ Server) We are a community based server, open to all personalities! Here you can meet new friends, talk about your favorite interests, or....meet your future lover! ꜰᴇᴀᴛᴜʀᴇꜱ ᴄʜᴀɴᴄᴇ ᴛᴏ ꜱᴜᴘᴘᴏʀᴛ ᴏᴡɴᴇʀ ꜱᴛʀᴇᴀᴍᴇʀ ᴅᴜɴɢᴇᴏɴꜱ ᴀɴᴅ ᴅʀᴀɢᴏɴꜱ ꜰᴜʟʟʏ ꜱᴜᴘᴘᴏʀᴛ ʙᴏᴛ ᴀɴᴅ ꜱᴜᴘᴘᴏʀᴛ ᴀɴᴅ...
datinglovefriendschill
T
The Safe House
0 голосов
𝗡𝗘𝗪 𝗦𝗘𝗥𝗩𝗘𝗥! 𝗟𝗩𝗟 𝟯 . 𝗔𝗖𝗧𝗜𝗩𝗘 (𝗠𝗜𝗡𝗜𝗠𝗨𝗠 𝗔𝗚𝗘 - 𝟭𝟴) . 𝗠𝗔𝗞𝗘 𝗙𝗥𝗜𝗘𝗡𝗗𝗦 . 𝗔 𝗟𝗢𝗧 𝗢𝗙 𝗖𝗛𝗔𝗡𝗡𝗘𝗟𝗦 . 𝗦𝗘𝗟𝗙 𝗥𝗢𝗟𝗘𝗦 . 𝗩𝗢𝗜𝗖𝗘 𝗖𝗛𝗔𝗧𝗦 𝗖𝗢𝗠𝗘 𝗝𝗢𝗜𝗡 𝗔𝗡𝗗 𝗛𝗔𝗩𝗘 𝗙𝗨𝗡 𝗖𝗛𝗔𝗧 <𝟯
socialgamingfriendschillhangout
T
✮ The doghouse (15+) !!
0 голосов
Hihi ☘ (15+) server We are a server full of artists and a bunch of. other people who love to chill , vc , chat and more! Most of us are from toyhou.se a popular artist site. We play games like vrc, Roblox and chill 🐶🐾 . we have active mods + open applications . artists and commissions ....
artchilltoyhouse
R
Rock Fusion
0 голосов
Hello! This is Rock fusion a server with rock and metal loving people. This is an English channel mostly but there is a channel where you can speak languages. We have activities like: Questions of the day song of the day album exchange album of the week And a,couple others so why not join?
musicchillmetalrock
P
Purple Domain
0 голосов
Welcome to the Purple Domain ━━━━━━━━━⛧ Inside the purple domain is a small group of people that are into Competitive games and Party games. We are home to all types of games like... Rainbow six siege Mario Party (Emulators online) Overwatch 2 And any other competitive games or just casual...
socialgamingchillnewmario party
S
Solstice
0 голосов
You are invited to Solstice! ·:¨༺ ♱Solstice♱ ༻¨:· ‧₊˚ ⋅Want a place to make friends and talk about identity v? We got you! Solstice was made to grow a community with people who play idv and want to make friends with other players! Here, you can have casual conversations, find people to play idv...
gamingchillhangoutidentity vidv
H
Hayat
0 голосов
Wir sind zwar eine gute Community, aber ohne dich fehlt dem Server ein Teil. ♡ Also Hop Hop, komm rein, damit wir die Stimmung ein bisschen bunter sehen ;) 𝐁𝐞𝐢 𝐮𝐧𝐬 𝐠𝐢𝐛𝐭 𝐞𝐬: Humorvolle Mitglieder Schönes Server Design | auf süß Eigener Server-Bot Giveaways wie zum Beispiel Nitro Boost...
animechillgermandeutschjugendtreff
S
Sky Of Stars
0 голосов
looking for active members !!!! Welcome to Sky of Stars! Looking for a laid-back community to vibe with after hours? We are a 14+ server built for those who love to relax, chat, and connect with like-minded people who share the same hobbies / interests. Whether you're sharing your latest anime...
datinganimefriendschillpartnerships
S
•⁕⁜╎✨𝙿𝚊𝚛𝚊𝚍𝚒𝚜𝚎 𝚘𝚏 𝙴𝚎𝚟𝚎𝚎𝚕𝚞𝚝𝚒𝚘𝚗𝚜✨╎⁜⁕•
0 голосов
•⁕⁜╎✨𝙿𝚊𝚛𝚊𝚍𝚒𝚜𝚎 𝚘𝚏 𝙴𝚎𝚟𝚎𝚎𝚕𝚞𝚝𝚒𝚘𝚗𝚜✨╎⁜⁕• ¡𝙱𝚒𝚎𝚗𝚟𝚎𝚗𝚒𝚍𝚘 𝚊 𝚎𝚜𝚝𝚎 𝚙𝚎𝚚𝚞𝚎ñ𝚘 𝚜𝚎𝚛𝚟𝚒𝚍𝚘𝚛 𝙴𝚗𝚝𝚛𝚎𝚗𝚊𝚍𝚘𝚛! -¿𝐓𝐞 𝐠𝐮𝐬𝐭𝐚𝐫𝐢𝐚 𝐞𝐯𝐨𝐥𝐮𝐜𝐢𝐨𝐧𝐚𝐫, 𝐩𝐚𝐬𝐚𝐫 𝐞𝐥 𝐫𝐚𝐭𝐨, 𝐜𝐨𝐧𝐨𝐜𝐞𝐫 𝐧𝐮𝐞𝐯𝐚 𝐠𝐞𝐧𝐭𝐞 𝐲 𝐜𝐨𝐧𝐯𝐞𝐫𝐭𝐢𝐫𝐭𝐞 𝐞𝐧 𝐮𝐧...
chillpokemonespanol
M
me when the
0 голосов
this is a server to hang out in, its pretty cool (well atleast i think it is), idk if itll invite u or not so if it doesnt ask for an inv (@moriohsweatshirt on discord) and the rules are in the server. have fun in da server
artchillsfw
T
texas
0 голосов
WELCOME TO TEXAS! Texas is... a motley crew of people. Most of us aren't even Texan. Or American, for that matter. Meet people like you, or people completely different from you! We're looking for new people to join the community all the time, to build friendships and enjoy activities and events...
socialcommunitychillhangoutvc
T
the oven!! 🍳
0 голосов
୨୧﹕┊new KNY themed server! with a welcoming community C: ꕤ﹕┊ vc games and bots;; confessions, truth or dare, yggdrasil, tupperbox etc ꒰﹕┊ please join! everyone here is very nice
gamesartchilldemon slayerkny
A
꒰ა ange͟lica ໒꒱ .
0 голосов
⠀⠀ ⠀:¨ ·.· ¨: ⠀ ⠀⠀ `· / ꒰ა ange͟lica ໒꒱ . 🪽﹒ angelic themed !! — sfw ﹒⌑﹒stox + active ┆﹒all users welcome ♡ ﹒⌣﹒stickers + emoticons • partnerships | p4p ﹒⌑﹒we will love to have you !
socialcommunitychatchillpartnerships
B
banana town 🍌
0 голосов
this is banana town. a whimsical land, powered by potassium, full of wonders for your silly little mind. make friends, eat banana, have fun. we like to think we're pretty funny and you'll most likely fit in as long as ur not a genuine weirdo we have quite a few members and we're all special in our...
communityfriendschatchillhangout
T
The Ones Whom are Not One
0 голосов
We are a small and welcoming server who are trying to group. We are also looking for new moderators as we go. Everyone is welcome to join.
friendsenglishchillsafe spacewelcoming
S
♥𝓒𝓱𝓲𝓵𝓵 𝓬𝓪𝓯𝓮 ♥
0 голосов
♥︎𝓒𝓱𝓲𝓵𝓵 𝓬𝓪𝓯𝓮 ♥︎ ——————✧◦♚◦✧——————⋆ ˚₊· ͟͟͞͞➳❥ We are a semi-toxic community who is still very welcoming and open to making your time here comfortable. ˚₊· ͟͟͞͞➳❥ Make plenty new friends here! ˚₊· ͟͟͞͞➳❥ We do partnership just be sure to dm the owner about it. ˚₊· ͟͟͞͞➳❥ Plenty of fun...
datingchillfriendnon toxicsemi toxic
S
[ 𝐂 𝐀 𝐅 𝐄 𝐒 𝐘 ]
0 голосов
This is a older community server that was built off of an older popular server we owned! this server is more relaxed, chill and less restrictive than most. here you can meet chill people, meet new friends, and talk about your interests. We are a very welcoming community!
socialcommunitygamingfunchill
M
🥢﹐meraki • games + social﹒♡!
0 голосов
✧ ﹒Te invitamos a Meraki, una pequeña comunidad en busqueda de miembros activos. Este server está hecho con el fin de tener conversaciones casuales sobre cualquier tema, amigar, jugar variedad de juegos y hacer voice chat.  ★☆ social + juegos + sfw ♡ ︶︶︶ Ofrecemos . . . ︶︶︶ ➷ ➷  ✧  Variedad de...
socialchillrandomcomunidadjuegos
T
The Safe Garden
0 голосов
Hi, and welcome to The Safe Garden! This server is still quite new, but you can join and help grow this server! We have friendly members and staff if you are looking to make new friends or play games with! There is many activities and games that you can play in this server, such as: -Super Smash...
communitygamingchillsmash bros
N
/narcula
0 голосов
narculas community server streamers and editors toxic events and giveaways soon be useful if you wanna be mod atm
gamingchillstreamersseige
S
something cool
0 голосов
something cool is lurking..................................................................................................
chillvcnirvanakanyeomori
...
...
Discordfy Logo

Лучшая платформа для открытия и продвижения Discord серверов. Присоединяйтесь к тысячам сообществ и находите людей с такими же интересами.

Лучшие серверы

  • Игровые серверы
  • Аниме серверы
  • Серверы майнкрафт
  • Социальные серверы

Ресурсы

  • Добавить сервер
  • Премиум
  • Блог
  • Поддержка

Юридическая информация

  • Условия использования
  • Политика конфиденциальности
  • Правила

© 2025 Discordfy. Все права защищены.

Discordfy.com не связан с Discord.

Discordfy means Discord for you :D