Вернуться домой
Top Ranking

Gaming Servers

Discover the best gaming servers on Discord

4956 серверы
Updated every 6 hours
G
↳ *Gumii's Planet* ༉‧₊˚✧
3 голосов
Последний голос 56w ago
꒰‧🚀☆༉‧₊˚. 𝗪𝗲𝗹𝗰𝗼𝗺𝗲 !! 𝗬𝗼𝘂'𝘃𝗲 𝗟𝗮𝗻𝗱𝗲𝗱 𝗼𝗻 𝗚𝘂𝗺𝗶𝗶'𝘀 𝗣𝗹𝗮𝗻𝗲𝘁 !! ₊˚ ‿︵‿︵‿︵୨୧ · · ♡ · · ୨୧‿︵‿︵‿︵ ˚₊ ᯓ★ ❝ 𝒉𝒎𝒎...𝒅𝒐𝒏'𝒕 𝒓𝒆𝒄𝒐𝒈𝒏𝒊𝒛𝒆 𝒕𝒉𝒊𝒔 𝒑𝒍𝒂𝒏𝒆𝒕? 𝑰 𝒕𝒉𝒊𝒏𝒌 𝒊𝒕𝒔 𝒂 𝒏𝒆𝒘 𝒐𝒏𝒆 !! 𝑾𝒐𝒖𝒍𝒅𝒏'𝒕 𝒉𝒖𝒓𝒕 𝒕𝒐 𝒔𝒕𝒂𝒚 𝒂𝒘𝒉𝒊𝒍𝒆. ❞...
socialcommunitygamingfriendshangout
S
♣『𝕻𝖆𝖑𝖆𝖈𝖊 𝕱𝖗𝖔𝖒 𝕳𝖊𝖑𝖑』♠
1 голосов
Последний голос 56w ago
Buenas!!!👋 ✧----------------➣ Somos un servidor nuevo con temáticas de Gaming, anime, mangas y social.✨ Aún estamos en pleno desarrollo por lo cual alguna sugerencia no vendría mal, aquí hay muy buen ambiente, personas muy sociales y sobretodo amigable. ¿Que esperas para unirte y amigar? 🎊Te...
socialgaminganimemangaespanol
W
wouin 𝜗𝜚 social ・friends ・chat
1 голосов
Последний голос 56w ago
♡・welcome 2 wouin .ᐟ・☆ ୨୧・┈┈・୨୧・┈┈・୨୧ ・freshly new server + sfw ・non-toxic and social ・aesthetic winter layout ・must be 15+ to join ・chill moderation ୨୧・┈┈・୨୧・┈┈・୨୧ ♡・join us if you want to make friends and share your interests with them. (remember, you MUST be 15+ !!)
socialgamingdatinganimeegirl
S
🔮・𝙂𝙡𝙤𝙗𝙖𝙡𝙑𝙞𝙗𝙚 𝘾𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮™
1 голосов
Последний голос 56w ago
➔ 🔮・𝙂𝙡𝙤𝙗𝙖𝙡𝙑𝙞𝙗𝙚 𝘾𝙤𝙢𝙢𝙪𝙣𝙞𝙩𝙮™ ┳━╍━╍━╍━╍━╍━╍━╍━╍━┳ Osnovne stvari o serveru: Server osnovan 20.10.2023, server je napravljen u cilju zabave druzenja i igranja igrica i slusanje muzike. ━╍━╍━╍━╍━╍━╍━╍━╍━ Nesto osnovno o serveru! ・Chill & Gaming Community. ・Kanali sredjeni u...
communitygamingchatactivegiveways
W
When™ but Discord
1 голосов
Последний голос 56w ago
When But Discord is a 16+ gaming/social server that’s based in the UK, but welcomes users from all around the world! We’re an amazing and fun community that’s always looking for new friends and gamers to chat with, we also possess an assortment of fun bots including Mudae, Dank Memer, Music Bots,...
socialgaminganimefriendschill
S
5. Wave
1 голосов
Последний голос 56w ago
🌊 Welcome to 5. Wave 🌊 The place where creativity meets the infinite horizon. 🌀 About Us: A community for those who crave depth, exploration, and connection. Whether you're an artist, gamer, dreamer, or thinker, 5. Wave is your sanctuary. Dive deep into the waves of creativity, share your...
socialcommunitygaminganimefun
S
·*~𝓡𝓞𝓤𝓖𝓔~*·
1 голосов
Последний голос 56w ago
••Welcome to ROUGE! •• Come join this community if you’re interested in making friends, gaming, making friends, and having fun! We do lots of fun interactive activities to grow our online social bonds and will only improve from here on out! Check us out if you dare >;).
gamingchillingmaking friendsroastingbeefing
A
AC - REALISTIC DRIVING
1 голосов
Последний голос 56w ago
SimRacing in jeglicher Art und Form Assetto Corsa, Assetto Corsa Competizione, BeamNG, ETS2 etc. Support Bereich + Hilfe Car Mods / Grafik Mods Discord Rank System EIGENE SERVER: 4x Nordschleife Tourist Server / 2x Street (Hot Lap), 2x GT3 (Hot Lap) 1x Shutoko Revival Project (SRP) Server +...
gamingmodsracingsimracingassettocorsa
D
DISTRITO ROJO
1 голосов
Последний голос 56w ago
๑꒷꒦︶꒦ ˚✦・꒷・┈・꒷・✦˚ ꒦︶꒦꒷๑ ୨୧┊¡Holaa! somos el Sv. Distrito Rojo. /ᐠ - ˕ -マ Una comunidad social - gaming de habla hispana para conocer personas nuevas, jugar y pasar el timpo. ୨୧┊ ¡Entra y desvélate viendo películas, jugando, farmendo con Nekotina o solo charlando con los miembros del servidor! Te...
socialcommunitygamingchillespanol
M
→﹐ ⛩ ﹒ Mσcнι﹒⟢
1 голосов
Последний голос 56w ago
☥looking for a fun server ?? ੭ ﹒e﹒ Ⲥⲏⲓⳑⳑ Ⲍⲟⲛⲉ !!. ‹3  ᶻz, hangout , games, etc﹒❰❰﹒e e ﹒⇆﹒++ more fun things﹒ ıllı e, hope to see u there byee e﹒༄﹒☆
socialgamingfriendlychillhangout
S
Skyblock.XYZ - Official
1 голосов
Последний голос 56w ago
「 Skyblock.XYZ 」 Welcome to the restart of a historic server! Skyblock.XYZ comes back to life in 2024 with all new features, builds and contests to win great prizes in! We've been keeping this quiet for much too long and are so thrilled to finally announce the recreation of a classic skyblock...
socialgamingminecraftgiveawaysskyblock
M
Metro Battles
1 голосов
Последний голос 56w ago
🚇 Explore the thrilling world of Metro Battles! Dive into action-packed rounds of cops and robbers across iconic locations like New Rock City, Tatyu Village, Beach, and the Grand Canyon. Each round lasts just 10 minutes, offering quick and intense gameplay. Win to earn coins and dominate the...
communitygamingrobloxdevelopment
F
⋆。‧˚ʚ frog’s town ɞ˚‧。⋆
1 голосов
Последний голос 56w ago
🌼Welcome to Frog's Town! 🌼 Hop into our adorable community where cuteness and friendship blossom! Whether you're here to make new friends, share your hobbies, or just relax, you'll find a warm and welcoming home with us. What We Offer: Lovely Chats: Join our heartwarming conversations and...
communitygaminghangoutfriendshipvc
T
[TL] The Triglet's Lounge
1 голосов
Последний голос 56w ago
Что ж... Ты очень нужен этому серверу, поверь. Без тебя никуда. Так что лучше зайди к нам, поздоровайся, посиди с нами в войсе, найди парочку друзей и поскидывай кекезных картинок, никто против не будет. Маленькое, но уютное коммьюнити. Мы тебя реально ждём.
gaminganimefriendlyartvoice
V
Vought International
1 голосов
Последний голос 56w ago
Chill and active community Memes Discussions about movies, TV shows, games, and fiction, join if you like The Boys, Breaking Bad, Supernatural, the Alien franchise, Dexter, or Star Wars
gamesmemeswatch partiesbreaking badthe boys
M
moonbeam arcade
3 голосов
Последний голос 56w ago
🌙🎮🕹️ moonbeam arcade ✧₊˚.⋆♡⁺₊✧ 🌙🎮🕹️ Hello there! Welcome to moonbeam arcade, the ultimate 18+ gaming and sims Discord server! 🌟🎮💫 Come join our amazing community, where you can make new friends, discuss your favorite games, and engage in lively conversations about life. With our top-notch...
gameshangoutchillgaming
S
𝙈𝙤𝙪𝙣𝙩𝙖𝙞𝙣 𝙂𝙤𝙖𝙩𝙨
1 голосов
Последний голос 56w ago
✨ Chill Vibes | Positive Community | Endless Fun ✨ Looking for a place to unwind, make friends, and just vibe? 🌊 Look no further! The Vibe Zone is your new digital hangout, where chill meets thrill. Whether you're here to chat, share memes, game, or just enjoy some good vibes, we’ve got you...
communitygamingchillhanging outvibes
S
𝓣𝓱𝓮 𝓓𝔂𝓷𝓪𝓼𝓽𝔂
1 голосов
Последний голос 56w ago
The Dynasty is a 18+ Discord server dedicated to supporting Twitch streamers. Join our crew to share tips, boost each other's streams, and engage in fun streamer challenges.
socialcommunitygamingstreamingtwitch support
C
👾・Chubi-Gang
2 голосов
Последний голос 56w ago
◦ °~ ¡Te presentamos la ツ Chubi-Gang 👾! Una comunidad creada pa los mas vios del pantano. -˚ Es un servidor Chileno activo, bien configurado y en constante crecimiento. Queremos que te sientas cómodo y que acá puedas encontrar un lugar para relajarte, divertirte y conocer gente nueva. ¿Que...
socialgaminganimeespanolchile
E
Empire of Dreamos
1 голосов
Последний голос 56w ago
Welcome and hello, we hope to create a server where you can get to know new people create friendships and much more! (If you have any ideas for the server please message the owner or co-owner)
gaminganimefriends
S
𝕋𝕙𝕖 𝔾𝕖𝕞𝕤𝕥𝕠𝕟𝕖𝕤 💎
1 голосов
Последний голос 56w ago
An FFXIV Community with dedicated channels for Roleplay, Screenshots, Creators and Tool Help. Come and chat, share screenshots & make new friends. Join for: ♡ Relaxed Atmosphere ♡ LGBTQ+ Friendly ♡ Making Friends ♡ Active Members ♡ Screenshots (N/SFW) ♡ Creator Channels ♡ Tool Help ♡ And...
gamingffxivff14final fantasy xivfinal fantasy 14
T
The Mud Hut
2 голосов
Последний голос 56w ago
Hi stranger! Welcome to our Discord server, where we're all about art, games, cars, and just hanging out. Whether you're an artist, a gamer, a car enthusiast, or just looking for a fun community with people you can connect to, you're in the right place. We've got plenty of channels and topics!...
communitygamesartrobloxcars
S
𝐆𝐫𝐚𝐥𝐥𝐞𝐦𝐨𝐥𝐞™
1 голосов
Последний голос 56w ago
Esi servera meklējumos? 🌐 Aicinām tevi pievienoties GRALLEMOLE kopienai! Mūsu serveris ir pilns ar iespēju un aizraujošiem piedāvājumiem, kas noteikti liks tev justies kā daļai no kaut kā īpaša. Šeit ir tikai daži no mūsu piedāvājumiem: ➥ Mājaslapa - Iepazīsties ar mūsu servera funkcijām un...
communitygamingminecaftlatvialatvija
U
UK Gaming Hub
1 голосов
Последний голос 56w ago
Welcome to UK Gaming Hub!🥳 We’re a 21+ friendly, tight-knit social and gaming community based in the U.K. We’d love for you to join and be part of the fun! Here’s what you’re missing out on… 🥺 💬 Active text & voice chats 🎉 Regular events: Saturday Gaming Night 🎮 Friday Movie Night...
socialgaminggamersuk21
H
🌱🎀💗Heavenly Meadow💗🎀🌱
1 голосов
Последний голос 56w ago
Small and new server with updates happening as often as possible! We offer many amazing features so please do come see!! This server is filled with chill people who are all amazing!!! Come join today and we’ll all leave a beautiful smile on your face, and don’t forget to invite friends 💗
gamingfriendslgbtqsfwmatchmaking
B
Bado badi Gang!
1 голосов
Последний голос 56w ago
Looking for a place to chill and relax? Look no further, Bado badi gand ek desi paki based server hai. Naye logo se milo dost banao hell dushmaniya banao for all we care bhai 💀 but bakchodi nai rukni chaiye.🇵🇰🇵🇰🇵🇰🇵🇰🇵🇰🇵🇰🇵🇰🇵🇰
gamingpakistanpakistanivibinglahore
S
⋆ Sina’s World
2 голосов
Последний голос 56w ago
✨ Sinners Hideout CHILL COMMUNITY COME JOIN AND PLAY GAMES AND CHAT 😺 • Join Frequent Give-aways • Invite-Rewards • Express yourself with Custom Roles • Custom Discord Bots
gaminganimemangagiveawaynitro
T
The Royal Veil
2 голосов
Последний голос 56w ago
🌸 Welcome to The Royal Veil! 🌸 A cozy, whimsical kingdom where fellow fans of manhwa, anime, gaming, and friendly connections gather under a royal banner. Step behind the veil and enter a world filled with lively discussions, exciting events, and unique characters who share your passions! ✨ What...
socialcommunitygamingmangamanhwa
S
/syringe
1 голосов
Последний голос 56w ago
:¨ ·.· ¨: *· . /syringe 𐂯ྀི fem owned looking for new mems >,..< ` semi-toxic ` gaming ` social ` emotes PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE JOIN or wtv 😭🙏🏻 play valorant with iori plz
gamingegirlsvciconsvalorant
D
Deltas Simple Domain
2 голосов
Последний голос 56w ago
(semi toxic server btw) Join it its really cool we have cool members and stuf like yeah we are cool and you should join 123456789029373925252622662622626622636363363636366336633663373636673737737373377337737337
gamesanimebleachdragon balljjk
M
MiningPlus
1 голосов
Последний голос 56w ago
Right now the server is Minecraft focused, but slowly we'll play different games Like lethal company or content warning! MiningPlus is a great way to meet people and build some cool stuff together. You could join with java or bedrock, and even explore the mods if you have java, which we have...
gamingminecraft15
A
Aura Kingdom♡Anime♡Games♡Friends♡
1 голосов
Последний голос 56w ago
ᐳ☽✰ 𝙷𝚊𝚒 𝚆𝚎𝚕𝚌𝚘𝚖𝚎 𝚝𝚘 𝙰𝚞𝚛𝚊 𝙺𝚒𝚗𝚐𝚍𝚘𝚖 ( ~-)~ 𝒪𝓋ℯ𝓇𝓋𝒾ℯ𝓌: ∙𝚃𝚘𝚗𝚜 𝚘𝚏 𝚅𝚊𝚛𝚒𝚎𝚝𝚢 𝙶𝚊𝚖𝚎𝚜 𝚕𝚒𝚔𝚎.. 𝙵/𝙶𝙾, 𝙶𝚎𝚗𝚜𝚑𝚒𝚗, 𝚆𝚞𝚝𝚑𝚎𝚛𝚒𝚗𝚐 𝚆𝚊𝚟𝚎𝚜, 𝙼𝚒𝚗𝚎𝚌𝚛𝚊𝚏𝚝, 𝚁𝚘𝚋𝚕𝚘𝚡, 𝚊𝚗𝚍 𝚎𝚝𝚌.. (⁄ ⁄•⁄ω⁄•⁄ ⁄)⁄ ∙𝙼𝚘𝚟𝚒𝚎 𝙽𝚒𝚐𝚑𝚝 𝙴𝚟𝚎𝚛𝚢...
gamesdatinganimefriendsvariety of games
C
༺Chaotic Arcade༻
1 голосов
Последний голос 56w ago
──-⋆⋅༺𝓒𝓻𝓲𝓶𝓼𝓸𝓷 𝔀𝓪𝓿𝓮𝓼༻⋅⋆-── Wassup, we're a variety game server/hangout feel free to join us and make some new gaming friends! just a heads up we're a bit chaotic but were also wholesome and chill. ·:¨༺ ✮What we have in our server✮༻¨:· ‧₊˚🖇✩ We have Dead by daylight, Minecraft,...
gamingtwitchstreamervibesvariety of gameschaotic but chill
2
25XX 🍂
1 голосов
Последний голос 56w ago
Join 2xRakais Server, The Owner Is A Famous Twitch Streamer Who is known for being on a stream with Kai Cenat, 2xRakai’s Server Has Daily Games, Active Chatter and Etc
gamesactivestreamerkai cenat2xrakai
B
Bean Club
3 голосов
Последний голос 56w ago
Hi this server about my twitch channel with have ver positive friendly safe place for everyone to no drama 1.Fun 2.positive 3.Gaming night 4.Vc daily Please follow rules and listen to staffs ^^ Enjoy your stay
gaminganimefuntwitchmanga
S
𝐑𝐞𝐟𝐢𝐧𝐞 𝐌𝐚𝐫𝐤𝐞𝐭
1 голосов
Последний голос 56w ago
. 🥶 /refine market   𓂃   reputable ♡ cheapest prices for products ♡ giveaways active  𓂃        ✦ ﹕ join us today! ||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||||​||...
gaminggamessteamsellingrefine market
M
Marvel Rivals™ Hangout
2 голосов
Последний голос 56w ago
Welcome to Marvel Rivals™ Hangout! We are looking to bring players who want to chill and make friends, play Quickplay or Competitive, and learn more about the game. We offer A safe space for everyone Consistent updates on Marvel Rivals Guidelines for every heros
communitygaminglfghangoutmarvel rivals
L
悟 Lightning Legends ⚡
3 голосов
Последний голос 56w ago
Nosso objetivo é promover diversão entre os nossos membros, fazemos sorteios, eventos e muito mais! Somos focados na parte de jogos de Dragon Ball (Dragon Ball Legends, Dragon Ball Dokkan, Dragon Ball Fighterz e etc), mas todos os públicos são muitos Bem-vindo (a) no servidor!
gamesdragon ball legendsdbldragon ball dokkandb legends
G
𓊆ྀིGlamour Hon𓊇ྀི
1 голосов
Последний голос 56w ago
🌟 Glamour Hon: A warm and inviting community awaits you! Whether you’re seeking your soulmate or a lifelong best friend, we’ve got you covered. As a brand-new server, we’re committed to creating a vibrant space where you can connect and thrive. What can you expect from Glamour Hon? Let’s dive...
communitygamingdatingsemi toxicoverwatch 2
F
Fisching Spot
1 голосов
Последний голос 56w ago
Do you like Roblox and Fisch and would like some friends to play with or talk to ppl that like the same stuff? Join our brand new Community server based around Fisch where you can talk to people that are just like you! We are trying to build a fun community of Fisch players that would like to chill...
communitygamingrobloxchattingfisch
L
Lotus Lake
1 голосов
Последний голос 56w ago
Welcome to the Lotus Lake, the area of good vibes and positivity. Meet new friends and maybe even be reunited with old ones. This is mostly a place to chill and engage in fun shit. You can call it escapism but we call it a community
gaminganimefriendlychillcomics
R
Requiem
1 голосов
Последний голос 56w ago
Requiem provides gamers from different countries, cultures and age groups with a safe environment that allows them to interact with, and expand their social circles. We strive to improve their quality of life with free added value in the form of content, events, and giveaways. We are the highest...
gaminggiveawayseventssea of thievesalliance server
G
GamerPaladset
1 голосов
Последний голос 56w ago
Gamer Paladset er en dansk community server, som går ind for at have det sjovt og møde nye mennesker! Vi spiller alle former for spil herinde, lige fra cs:go, til valorant til Minecraft. Vi laver ugentligt events, med vores eget point system, som kan udløse gavekort til diverse platforme! Udover...
communitygamingeventsdanskf llesskab
T
Tartrazine
1 голосов
Последний голос 56w ago
just another server. but the owner (smokin hot btw) is trying to form a small, like minded friend group. please join pls pls pls pls pls pls please please please pls pls. join.
communitygaminganimefriendsemojis
K
Kerliges Reich
1 голосов
Последний голос 56w ago
Hey, Suchst du einen durchschnittlichen, langweiligen Server, bei dem du dich an Millionen von Regeln halten musst und den es schon Tausend mal auf Discord gibt? Ich hoffe mal nicht, denn unser Server ist so ziemlich das genaue Gegenteil. Du musst dich nur an ein paar Basic Regeln halten, damit du...
gaminghumorrainbow six siegeschwarzer humor
...
...
Discordfy Logo

Лучшая платформа для открытия и продвижения Discord серверов. Присоединяйтесь к тысячам сообществ и находите людей с такими же интересами.

Лучшие серверы

  • Игровые серверы
  • Аниме серверы
  • Серверы майнкрафт
  • Социальные серверы

Ресурсы

  • Добавить сервер
  • Премиум
  • Блог
  • Поддержка

Юридическая информация

  • Условия использования
  • Политика конфиденциальности
  • Правила

© 2025 Discordfy. Все права защищены.

Discordfy.com не связан с Discord.

Discordfy means Discord for you :D