Ajoutez votre serveur Discord

Découvrez des serveurs incroyables

Explorez des milliers de communautés Discord. Trouvez des personnes partageant les mêmes intérêts et faites partie de quelque chose de spécial.

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
P
Phone Photography
0 votes
Hello :) Our server has been revamped and made better than ever before, now being more clear and concise for anyone joining the server. :) In our server you will find: Photography 📷 and videography 🎥 channels specifically for content shot on smartphones 📱 Frequent Photography Competitions with...
photographycamerapixeliphonephone
K
KIN Gaming
0 votes
KIN Gaming is our new community specifically tailored for gamers! We have decided to grow our ambitions to things beyond just an individual game. We truly enjoy meeting people of all sorts - and seeing the different types of games and genres that we all like in one place is much more convenient! We...
rpgsmobile gamesmmospvp competitivesurvival crafting
D
Daiki's Domain
0 votes
Official Discord server of Daiki. goatdaiki otherwise known as Daiki is a content creator and streamer who makes a variety of different videos; mostly based upon gaming, Omegle, trolling, or irl. He's best known for his insanely clean gameplay and humorous character.
socialcommunitygamingfuncontent
U
Universal Bizzare Trading
0 votes
˗ˏˋ Universal Bizarre Trading Server´ˎ˗ ➸ About us: Universal Bizarre Trading Server is a Roblox trading server that is mainly based on anime games such as Sakura Stand. We mainly do Sakura Stand giveaways, but we can also do AUT giveaways, for example. ➸ What you can expect from us: • Nice...
sakura standa universal timeyba tradingstand awakeningstand upright rebooted
E
EdenCraft┊SMP
0 votes
[NEW JUST RELEASED SERVER] [1.21 SMP] Come join us at EdenCraft; a mature, nature-themed minecraft and discord server! ♡ Minecraft Survival Server | Semi-Vanilla | 200+ Emojis | Custom Bots
communityminecraftsurvivaljavasmp
S
𝐄𝐓𝐂𝐇𝐄𝐃 𝐅𝐋𝐀𝐌𝐄𝐒: 𝐀 𝐃𝐀𝐑𝐊 𝐒𝐎𝐔𝐋𝐒 𝐄𝐗𝐏𝐄𝐑𝐈𝐄𝐍𝐂𝐄
0 votes
🔥 🔥 🔥 🏰 🔥 🔥 🔥 LOTHERIC. AWAITS. UNKINDLED. ═════════════════ 𝘖𝘱𝘦𝘯 𝘺𝘰𝘶𝘳 𝘦𝘺𝘦𝘴 𝘢𝘴𝘩𝘦𝘯 𝘰𝘯𝘦. 𝘛𝘩𝘦 𝘧𝘭𝘢𝘮𝘦 𝘣𝘶𝘳𝘯𝘴 𝘥𝘦𝘦𝘱 𝘢𝘳𝘰𝘶𝘯𝘥 𝘺𝘰𝘶. 𝘠𝘰𝘶𝘳 𝘤𝘢𝘭𝘭𝘪𝘯𝘨 𝘢𝘸𝘢𝘬𝘦𝘴 𝘵𝘰 𝘮𝘢𝘴𝘵𝘦𝘳 𝘵𝘩𝘦 𝘦𝘮𝘣𝘦𝘳𝘦𝘥 𝘧𝘭𝘢𝘮𝘦. 𝘛𝘢𝘬𝘦 𝘶𝘱 𝘺𝘰𝘶𝘳 𝘴𝘸𝘰𝘳𝘥...
rpactiondark soulsdark fantasysoulsborne rp
U
United States of Pakistan
0 votes
"CHILLIN' WITH MY PAK HOMIES" is a dynamic server designed to foster a vibrant and welcoming community atmosphere among Pakistani individuals and enthusiasts from around the globe. Nestled in the digital realm, this server serves as a virtual gathering place where members can connect, share, and...
desipakistanurdupunjablahore
G
┊ ˚➶ 。˚ 🕷 Gothii
0 votes
✶﹒ ° . ⊂⊃﹒ ° . ° Gothii ✦ ° ﹒⟡﹒100% sfw server . ° why should you join us ? ﹒⊂⊃﹒ . ° here at Gothii, we are a respectful and safe community, we support the lgbtq+ and we do not tolerate any discriminative // offensive acts . ° . ° we have respectful and welcoming staff, mods, admins, owners,...
communityfriendlysfwgothgothic
V
VALORANT Mobile Türkiye
0 votes
VALORANT Mobile Türkiye topluluk sunucusuna hoşgeldiniz! VALORANT Mobile, Riot Games tarafından geliştirilmekte olan 5v5 aksiyon ve taktiklerle dolu bir FPS oyunudur. Discord Hakkında Bu Discord sunucusu Türk VALORANT Mobile oyuncuları için yapılmıştır. Burada, oyun hakkında yenilikleri...
mobileandroidiosvalorantvalorant mobile
G
Gibbyland
0 votes
-This server is for anyone into the music of the Bee Gees (or just 60's/ 70's/ 80's music in general). -We regularly have events and listening parties -As the owner I aim to be as active as possible Inclusive and accepting towards anyone Hope you enjoy it :)
music70sbee geesdiscothe bee gees
S
Smallfry Clan: Refried
0 votes
After the tragic loss of our leader during the clash of clans, we have returned. Chill server to complain about Splatoon or throw up in Join if silly or deranged Gay hogs unlimited Bug yuri! 16+ only please
splatoonyurinormalwalmart
S
اسم السيرفر
0 votes
Had Server rir Troll ou ymkn like t9sr fih games B7al - Roblox - Brawlhalla - ( Valo wakha li kayl3boha losers ) Etc Join and make friends if u want rir matkonch 7amd https://discord.gg/9TzgW5by5p
gamesmarocmoroccotrollgoffy
N
Nocturnal
0 votes
Welcome to Nocturnal Valorant Haven! Embrace the night vibes as we dive into the world of Valorant. Whether you're a nocturnal gamer or just looking for some late-night fun, join us for relaxed or serious matches. We’re a startup server that welcomes you to our hangout!🌙
socialgamingasiavalorantvalorant asia
S
🧬Science & Research🪐
0 votes
Join our vibrant Science Discord community! Engage in lively discussions on topics like quantum entanglement, white holes, genetic engineering, generative AI and more. Connect with passionate individuals, from high school students to PhD scholars, who share your curiosity. Share your projects, seek...
socialfriendlyhangouttechnologyscience
Y
YoutubePromos
0 votes
🔹 Welcome to YouTube Promotion! Join a vibrant and engaging community of content creators and YouTube enthusiasts! 🔹 Grow Your Channel Maximize your YouTube stats effortlessly—purchase our reliable services for subscribers, likes, and watch time! 🔹 Supportive Environment Connect with fellow...
youtubesubscriberslikesfollowerswatchtime
T
The Afterlife Bar
0 votes
A server for teens to connect with each other, make friends, play games, debate, etc. I aim to keep the server peaceful, equal and friendly to all.
gamingmusicdiscussionteenagersbased
B
✿ BPD Haven ✿
0 votes
✿ Welcome to BPD Server 3.0 ✿ We’re a 18+ server that wants to create a welcoming community for people with Borderline Personality Disorder and their loved ones. What we offer: ✿ Vent channels and a vent vc ✿ A Gaming channel and a gaming vc ✿ An Economy, including ranks, and roles you can...
socialcommunityventbpdemotional support
T
theBookofH - YT
0 votes
if you like weed and weed products I review weed pens or thc carts and other things so check out my channel and my discord server if you're interested thank you https://www.youtube.com/channel/UCUAXQn_NnsUQslfd3pNgbYg
communityyoutubervibemichigan
J
Jaycie's Femboy Disciples
0 votes
hi im jaycie join my femboy server and be my disciple !! (we have femboy pics for 15+ and u must be level 5!!!) 13+ !! you dont have to be a femboy :3 achieve heaven
13cuteboyssillyfemboy
T
The Alumni Block©
0 votes
░█████╗░██╗░░░░░██╗░░░██╗███╗░░░███╗███╗░░██╗██╗ ██╔══██╗██║░░░░░██║░░░██║████╗░████║████╗░██║██║ ███████║██║░░░░░██║░░░██║██╔████╔██║██╔██╗██║██║ ██╔══██║██║░░░░░██║░░░██║██║╚██╔╝██║██║╚████║██║ ██║░░██║███████╗╚██████╔╝██║░╚═╝░██║██║░╚███║██║ ╚═╝░░╚═╝╚══════╝░╚═════╝░╚═╝░░░░░╚═╝╚═╝░░╚══╝╚═╝ SICK...
cryptocurrencybitcointradingnftdefi
R
Render To Class Now Server
0 votes
═════════════════════════ ──▸⎾Render to Classe Now Server⏌◂── ═════════════════════════ Venha conhecer o server Render to Class Now e ajudar a reviver o nosso server. Um servidor feito para pessoas da área das artes interagirem. O nosso servidor é voltado para o público adolescente, então se você...
socialhumorbrasilarteanimacao
K
King Promotion
0 votes
🌎┤Español En este servidor puedes publicitar tus redes sociales y servidores de Discord de forma gratuita, también puedes socializar con nuestros miembros y pasar el rato. Hacemos afiliaciones con servidores, requisitos: tener más de 200 miembros. ¿Qué ofrecemos? ╭📢 Publicidad gratis ┊💵...
socialspampromotionespanolpromocion
P
Prehistoric Times 🦖
0 votes
「 🎸 𝐑𝐨𝐜𝐤 𝐍 𝐑𝐨𝐥𝐥 🎸 」 "Home of Rock N Roll" • Established on January 1st, 2024, Rock N Roll is a music hangout server designed for music lovers to share their interests with others. We are dedicated to all types of music like pop, rock etc. We have multiple channels to talk about...
musicguitarrockpopone direction
C
Camp: Camping Trails! (C:CT!)
0 votes
(SIGN UPS OPEN) Hello this is a brand new object camp season 1 called Camp: Camping Trails! It’s a outdoors themed object camp with me your host possessed frisbee! This is a more fun laid back but long term camp so zip up and come join in our goal is 15 sign ups! Ps your object isn’t required to...
object campsign ups openseason one
T
The Soul Garden | One God and One Lord
0 votes
Emphasizing truth seeking and a prayer life. Acts 2:36-38 "Let all the house of Israel therefore know for certain that God has made him both Lord and Christ, this Jesus whom you crucified.” Now when they heard this they were cut to the heart, and said to Peter and the rest of the apostles,...
christianjesuschristianitynon denominationalunitarian
0
🎀 ; 00:00 ﹏ schmiddycord
0 votes
hihi ! welcome to our server ! sooo … what is pppfw ? our server is mostly a hang out + safe space for those who enjoy genshin impact , honkai star rail , rpg horror games , and other games like those listed ! our server is lgbtq + and system friendly ! our server is a safe space for anyone who...
genshin impactomorirpg horrorshonkai star railreverse 1999
S
𝑀𝑦 𝐻𝑒𝑟𝑜 𝐴𝑐𝑎𝑑𝑒𝑚𝑖𝑎: 𝑁𝑒𝑥𝑡 𝐿𝑖𝑓𝑒
0 votes
My Hero Academia: Next Life. ━━━━━◥◣◆◢◤━━━━━ Server Lore. A few years after the discovery of superpowers now known as quirks, many people started to manisfest more and more powerful quirks each generation. There was one man who couldn't walk on equals grounds with that powerful generation as he...
roleplaymy hero academiabnhamhamha rp
C
ChillZone
0 votes
Come join chillzone chill, hangout, make friends!, and Play games. Come meet our amazing staff and be apart of our chill and friendly atmosphere! What you waiting for join now
gamingchillsfwmake friends17
K
Kerriehab
0 votes
Are you stuck with Nofap? Tired of failing every day? Kerriehab is here to help you on your journey to quitting PMO and fulfilling your potential! We talk, share and help each other mostly with NoFap, but also with working out, meditation, mental health and more. Join now and take your life...
communitynofapself improvementrecoveryaddiction
S
STOIC LEARNERS : OG
0 votes
🟢Study With Me Discord: Productivity & Safe Study Environment , It's a server of Study with me YouTube streamer 🔴 STOIC X , and there are a lot of things are going on in the server for the time being. ✅Positive, respectful atmosphere ✅Study rooms ✅JEE/NEET DOUBT SOLVING ✅Shared resources &...
studyeducationstudy togetherstudy with mestudy community
F
Forgotten Dream ; PJSK AU Fandub
0 votes
We are a Project Sekai AU server with new units and different character interactions! We have our own lore written and are planning on releasing episodes soon. There are still voice acting and staff spots available so come join!
hangoutvoice actingfandubproject sekaishuffle au
R
🎀  reality  𓈒 ⌓ ⌓
0 votes
WELCOME TO REALITY! we're a decor server with loadsss of stuff ! Templates, masks, gifs and the likes ! ♡ We're not proship centered but we're targeted at people banned from other decor servers for being "problematic" (o_ O ᐡ) We hope you can see you 2day!!!!!! We don't bite trust \⁠(⁠^_⁠^⁠)⁠/
pixelsdecorsystem friendlytemplatesproship
D
DREMOS DESIGNS
0 votes
𝘿𝙧𝙚𝙢𝙤'𝙨 𝘿𝙚𝙨𝙞𝙜𝙣𝙨 𝙄𝙨 𝙖 𝘾𝙝𝙖𝙞𝙣 𝘿𝙚𝙫𝙚𝙡𝙤𝙥𝙚𝙧 𝘿𝙞𝙨𝙘𝙤𝙧𝙙 𝙛𝙤𝙧 𝙁𝙞𝙫𝙚𝙈 𝙏𝙝𝙖𝙩 𝙁𝙤𝙘𝙪𝙨𝙚𝙨 𝙤𝙣 𝙏𝙝𝙚 𝘾𝙤𝙣𝙨𝙞𝙨𝙩𝙚𝙣𝙩 𝙌𝙪𝙖𝙡𝙞𝙩𝙮 𝙊𝙛 𝙏𝙝𝙚 𝘾𝙪𝙨𝙩𝙤𝙢𝙚𝙧'𝙨 𝘾𝙝𝙤𝙞𝙘𝙚. • 𝘾𝙪𝙨𝙩𝙤𝙢 𝘾𝙝𝙖𝙞𝙣𝙨 • 𝙋𝙧𝙚𝙢𝙖𝙙𝙚 𝙅𝙚𝙬𝙚𝙡𝙧𝙮 •...
fivemjewelrychainsfivemchainsfivemchain
B
Blue Exorcist
0 votes
----The Reddit/Wiki Blue Exorcist Discord Server---- -Active Staff! -Cool Emotes! -Fun Community! -Blue Exorcist Talk!
animemangablue exorcistao no exorcistexorcist
S
𝔾𝕒𝕪 𝔹𝕒𝕓𝕪 𝔾𝕣𝕒𝕧𝕖𝕪𝕒𝕣𝕕
0 votes
Welcome to Gay Baby Jail, where the suffering is endless and the members are always homo! We may be a small group but we prefer it be that way, quality over quantity, right? We’re pretty active on the daily and we’ve gotten many iconic members who’ve joined and stuck around with us throughout this...
friendsmemeslgbtqcasualgiveaway
B
barney calhoun wife server
0 votes
﹒ ︵︵︵︵ ﹒ 🪼 ﹒ ︵︵︵︵ ﹒ O1 — ## silly valve & half life/hlvrai server O2 — ## full of awesome yuri and yaoi O3 — ## i know blue shift kind of sucks but it is my favorite O4 — ## pluralkit (chill like that) ﹒ ︶︶︶︶︶︶︶︶︶︶︶︶︶︶ ﹒
tf2half lifeportalvalvehlvrai
M
Moth cult
0 votes
Moth cult Server. We're a growing community with a minecraft server. Not really a cult yet, but one day. Join us, have fun, game, worship Catha'Vi. :3
communitychillcultmothsmoth
C
Cookie StØr3 #1K
0 votes
Está procurando aquele famoso "Nitro Gaming" ou impulsos para o seu servidor? Então sua busca chegou ao fim! Aqui na Cookie St0re, você encontra esses produtos com os melhores preços do mercado, além da segurança que é nossa prioridade! Venha conferir.
discordnitrostorevendaslojas
W
World of Darkness: USA
0 votes
Dedicated to the World of Darkness as a whole, we're a brand new community based server dedicated to networking local Chronicles in the United States. Our intention is to give you a resource that will help Players and Storytellers find one another across America. Come help us build a community and...
united statesworld of darknessvampire the masqueradewerewolf the apocalypsemage the ascension
T
The Betterment
0 votes
The world has infinite potential, we are here to unlock it and give everyone a fair chance to unlock their potential This server has a safe chat, an unsafe chat, and a NSFW chat, all seperated by roles and different rules, if you want to swear and speak of NSFW topics go to the roles channel and...
gamingminecrafteducationhealthmental
T
Timelines Collided 3
0 votes
no power limit, as long as you don’t go crazy with your power Welcome to the Multiversal Roleplay, where limitless adventures await! Unleash your imagination and embark on epic battles or team up to defeat evil foes. There are no boundaries to what you can achieve here. So, whether you're a...
communityfunroleplayenjoyable
H
♡❀˖⁺. Hα૨ɱσɳყ Hαѵεɳ ˖⁺. ❀♡
0 votes
🏛️ Welcome to the Seraphine’s Justice Court! 🏛️ Step into our realm of positivity, where kindness rules and gaming, chats, and good vibes unite us all! Our 16+ all-girls server is more than just a community—it’s a safe haven where we stand together to create a non-toxic, SFW space for everyone...
gamingsupport16justicegirls only
M
⋆ ˚。⋆୨୧˚ Matchmaking Heaven ˚୨୧⋆。˚ ⋆
0 votes
·͙̩̩͙˚̩̥̩̥̩̩̥͙ ✩ ̩̩̥͙˚̩̥̩̥̩̩͙‧͙ Hello there! Matchmaking Heaven is a girl ran server for non men (between the age of 13 and 20) looking for a safe space, friends and/or a partner! We have a matchmaking system based on a form that is very easy to fill. We use tickets for suggestions! We have a...
lesbiansafeaestheticsapphicmatching
E
Empire of Shadows
0 votes
I created this channel to party up with friends, well i got board and played around with some things. I have decided to share the server with you guys. general channels to talk about anything and everyting, Gaming channels to talk about all things gaming. There are also a couple TempVoice channels...
minecraftwarframesea of thievesgrand theft autovalorant
S
アニメ村 ☆ 𝐀𝐧𝐢𝐦𝐞 𝐕𝐢𝐥𝐥𝐚𝐠𝐞
0 votes
Join to beat the owner in our weekly gooning tournament (you won’t win 😞) Hi! This is an anime server where you can chat and make friends in! Our server is new and pretty small, but we hope to grow it. Come chat with us, we really talk about anything here!
communityanimefriendschathangout
...
...
Mise en avant Premium

Amenez votre serveur au niveau supérieur

Mettez en valeur votre serveur et attirez beaucoup plus de membres avec les fonctionnalités exclusives du plan Premium

Mis en avant dans les recherches

Votre serveur apparaît en vedette dans les recherches et catégories

Badge Premium + Couleurs

Badge exclusif et jusqu'à 7 couleurs personnalisées pour votre carte

Épinglé en haut

Avec le plan Sponsor, restez épinglé en haut de la page d'accueil

S'abonner PremiumVoir tous les avantages

Questions fréquemment posées

Obtenez des réponses à vos questions sur Discordfy

Discordfy Logo

La meilleure plateforme pour découvrir et promouvoir des serveurs Discord. Rejoignez des milliers de communautés et trouvez des personnes partageant les mêmes intérêts.

Meilleurs serveurs

  • Serveurs de jeux
  • Serveurs d'anime
  • Serveurs minecraft
  • Serveurs sociaux

Ressources

  • Ajouter un serveur
  • Premium
  • Blog
  • Support

Légal

  • Conditions d'utilisation
  • Politique de confidentialité
  • Directives

© 2026 Discordfy. Tous droits réservés.

Discordfy.com n'est pas affilié à Discord.

Discordfy means Discord for you :D