Retour à l'accueil

Serveurs Discord Fantasy

Découvrez les meilleurs serveurs Discord dans la catégorie fantasy

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
T
The Masked Truth
1 votes
Dernier vote 53w ago
𝚃𝚑𝚎 𝙼𝚊𝚜𝚔𝚎𝚍 𝚃𝚛𝚞𝚝𝚑 ────────────────────────────── (This is a relatively new/revamped and upstarting server. So don't be afraid to join!) Now, in the year 4005, the world has forgotten the true past and adopted a twisted version spoon-fed to them by the Emperor and his knights of...
roleplayrpfantasymedievalguilds
A
Alberram
2 votes
Dernier vote 53w ago
Alberram - Fantasy Roleplay Server [Java] [Vanilla] [1.20.2] [16+] Alberram is a fantasy medieval rp server that prides itself on its creative freedom. Our lore is short & easy to read; the only limit being your own imagination! ⊹⊱- COMPLETELY FREE: We don't ask for donations, subscriptions, or...
minecraftroleplayfantasymedievalminecraft roleplay
D
Die MAGISCHE Welt
1 votes
Dernier vote 53w ago
Die MAGISCHE Welt Ein Fantasy RP Die Story: Schon seit unzähligen Jahren leben hier vier Gruppen, genannt Delatras, die sich untereinander nicht so gut verstehen. Sie haben schon unzählige Kriege ausgefochten und sind sich immernoch nicht einig geworden. Jedes Delatra hat bestimmte Fähigkeiten:...
roleplayfantasyrpgmagicmagie
O
Ophelia-Bay (Omegaverse-Story RP)
1 votes
Dernier vote 53w ago
╔══❖════════════❖══╗ ੈ✩‧₊˚ Willkommen auf Ophelia-bay! *ੈ✩‧₊˚ ┊┊┊✧ ⁺ ⁺ ☾ ⋆・゚:⋆・゚ ┊┊✧ ⁺   ┊✧ ⁺ ⁺   Eine Trauminsel abgeschottet vom Rest der Welt, gefüllt von Möglichkeiten, Magie und vor allem - Pheromonen. Auf Ophelia-bay ist jeder willkommen, so besagt die reise Broschüre es zumindest....
rpfantasydeutschrollenspiela b o
T
The Long Night - Dark Fantasy RP & ERP [18+]
1 votes
Dernier vote 53w ago
[18+] Main themes: Dark Fantasy, Vampires, Exploration, Pirates, Undead, Medieval Fantasy, Erotism, Graphic Violence & Mythology. 🌙Are you ready to embark on a thrilling journey through the shadows of a new continent? Welcome to our immersive roleplay server set in a dark fantasy realm where...
roleplayrpfantasyerpliterate
Z
ᶻz ◜ Sleepy Whitebridge ◞ ☾
1 votes
Dernier vote 53w ago
`` Welcome to Whitebridge. A town on a small island north of Europe, Lynanorth. Whitebridge has always been a bit peculiar. Stories have been passed down by residents about the supernatural and paranormal activities of the town. They say the whole island is like this, but Whitebridge is the root...
roleplayenglishfantasysmall town
D
Daybreak Storyline - Fantasy/Fiction Roleplay 18+ (WIP)
3 votes
Dernier vote 53w ago
In the beginning, there was The Light. It created the Titans, tasked to create the universe as they see fit. The Titans crested the universe and galaxies within it. They couldn’t fill in this blank canvas alone. They then created the Exhalted Dragons, majestic creatures of divinity and purity,...
roleplayrpfantasyerpliterate
C
Camp Halfblood [18+ RP]
3 votes
Dernier vote 53w ago
A Percy Jackson inspired Roleplay Fantasy | Romance | Adventure | FSK 18+ | Slice of Life | Mythology | Group Roleplay The gods of Olympus have long been known for frequently having their disagreements. Oaths between them are increasingly broken, and a war among the ranks of the almighty...
roleplayrpfantasypercy jacksoncamp halfblood
T
The Voyage | Sci Fi RP
1 votes
Dernier vote 54w ago
The year is 2124, our solar system has recently been fully colonized, with some sort of civilization on each and every planet, some more wealthy than others, with Mercury bringing power from our star into each and every home. Daily life is sweet and mundane; paradise. However, there was always...
roleplayrpsci fifantasyspace
R
Raven's Heart
2 votes
Dernier vote 54w ago
All along the western Sword Coast lay the very diverse and populated cities of Triboar, Waterdeep, and Neverwinter, standing out against the landscape. Amongst the wilds and surrounding nature between these cities lies a burgeoning town, nestled between the northern Sword Mountains and the Dessarin...
roleplayfantasydndwestmarchavrae
T
The Everlasting Conflict: Blood War
2 votes
Dernier vote 54w ago
The Ascended race is one highly advanced in every aspect of their existence. They are so advanced, in fact, that the universe has become their genetic sandbox, allowing them to create races of their very own. One of these races made many years ago was called the Blood Wraiths. However, due to the...
roleplayrpsci fifantasyliterate
S
𝑴𝒊𝒔𝒕𝒔 𝑶𝒗𝒆𝒓 𝑳𝒐𝒏𝒅𝒐𝒏
2 votes
Dernier vote 54w ago
(𝟮𝟬+) London, 1890 ⁠⁠ ㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤ— We have reached the brink, and fail to see where the end drops off. Though London is familiar with creeping smog, where coal smoke belches across the skyline and settles above the city, an impenetrable fog has befallen England’s capital. Whereas some have...
roleplayfantasysupernaturalvictorianhistorical
T
The Library.
1 votes
Dernier vote 54w ago
Please note this server is brand spanking new so if you join, yes its going to be empty. At its core The Library is a location placed outside of time, space, fiction, reality, and logic. Acting as an archive of texts, objects, flora, and fauna from across an infinite number of universes and...
roleplayrpfantasy
S
惠𝐋𝐨𝐭𝐮𝐬 𝐕𝐚𝐥𝐥𝐞𝐲龍 𝐑𝐏
3 votes
Dernier vote 54w ago
————-﹒[ What do we offer? ] ﹒-———— OC friendly environment, possibility of writing your own story with others. Detailed and still expanding world lore Roleplay and simple Dice/rpg encounters Simple/Flexible Magic system Asian Culture setting Welcoming space for any roleplayer no matter their...
roleplayfantasyasiaocopen world
B
Binding Magic
1 votes
Dernier vote 55w ago
In the magical realm of Elarion, six elemental kingdoms clash for power, their destinies intertwined with the mystical Aether Core. This ancient crystal, the source of their magic, is now unleashing devastating natural disasters, a consequence of their endless wars. Can they mend their fractured...
roleplayrpfantasyfantasy roleplay
L
Loved you at first sight
1 votes
Dernier vote 55w ago
Modern , MxM roleplay server. Currently in the process of being remade. New heaven, the home of saints, is a city located in New York. The year is 2025. New heaven is known for its endless entertainment. There are amusement parks, vast beaches, arcades and expensive malls. Its immaculate...
roleplayrpfantasyerp
M
Musikalischer Genuss
1 votes
Dernier vote 55w ago
Ein kleiner aber feiner Server, wo es um "Gaming" und "Musik" geht. :) Anime und anderer kram ist natürlich auch vorhanden. Wer also joinen will, und eine schöne Zeit haben will, ist hier herzlichst willkommen. Ich halte euch nicht auf, zu joinen! :D Ebenfalls würde ich mich darüber freuen, neue...
communitygaminganimemusicfantasy
T
The Good Ol' Days
1 votes
Dernier vote 55w ago
🌵 Welcome to The Good Ol' Days 🌵 An 18+ Dark Wild West Roleplay Experience 🔫 Step into a gritty, unforgiving Wild West where every decision could be your last. The Good Ol' Days is an 18+ roleplay server where dark themes, complex characters, and moral ambiguity rule the land. Set in the...
roleplayrpfantasy1800 swild west
W
World of Scarlet
17 votes
Dernier vote 55w ago
The World of Scarlet (16+) Greetings new blood, and welcome to the World of Scarlet, a dark, low fantasy-themed roleplay server. The World of Scarlet's roleplay takes place on a singular, massive continent within the world itself, on which the Scarlet Faith dominates. The world has existed for...
mysteryhorrormedievalfantasyroleplay
T
The Haven
2 votes
Dernier vote 55w ago
Welcome to The Haven! 18+ only - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Three years ago, scientists were working on a cure for cancer when they dropped the wrong chemical into the mixture. It turned into a gas and began to spread across the world. Some of the people became a bit...
roleplayrpfantasythe haven
M
💫Multiverse Protection Organization💫
1 votes
Dernier vote 55w ago
Once upon a time, in an endless void, the two overgods Dars, the god of all darkness and chaos, and Kira, the goddess of light and guidance, created a being of massive power: Porgyal, the god of space. With the sheer power set free from its birth, it set the foundation for the multiverse as we know...
roleplayrpfantasymagicmultiverse
Q
Quinora - A Tale of 5 Seasons
1 votes
Dernier vote 55w ago
𝒬𝓊𝒾𝓃𝑜𝓇𝒶 — 𝒜 𝒯𝒶𝓁𝑒 𝑜𝒻 5 𝒮𝑒𝒶𝓈𝑜𝓃𝓈 ⚔︎ ──── ♔ ──── ⚔︎ 🞜 Over a century ago, the once separated continents of Quinora collided into one big super-continent, creating a shock wave and a magical reaction that shook their world. This event is known as the Collision, it forever...
roleplayrpfantasyfantasyrperp
S
ɴʏ́ ᴠᴏɴ ɪsʟᴇ
1 votes
Dernier vote 55w ago
[21+ only] [Modern/urban fantasy with a quaint old-world flavor] [Freedom to plot and make connections] [Server, characters, and setting are dynamic] Server site: https://nyvon.weebly.com/ Ný Von Isle is a land of mysticism amidst the mundane. An island of quaint Scandinavian beauty and a high...
roleplayfantasyfantasy rpmodern fantasy21
S
𝐸𝑃𝐼𝐶 // 𝑎 𝑔𝑟𝑒𝑒𝑘 𝑚𝑦𝑡ℎ𝑜𝑙𝑜𝑔𝑦 𝑟𝑝 𝑠𝑒𝑟𝑣𝑒𝑟
1 votes
Dernier vote 55w ago
This is a server made mainly from EPIC : The Musical, but it isn't limited to just EPIC. All Greek Myhtology related media ( e.g. HADES, Hadestown, PJO, The Song of Achilles etc... ). It isn't solely for minors, and it isn't 18+, most are welcome, but PLEASE, don't show up if you're like 2000 years...
roleplayfantasygreek mythologypercy jackson and the olyepic the musical
L
Lesser Isekai Academy / 小さな異世界学院]
1 votes
Dernier vote 55w ago
🌌Lesser Isekai Academy / 小さな異世界学院] 🌌 ✨ This is the place for all things chatting, vibing, and finding your people! Rant about your day, dive into epic convos, or join our legendary squad of Roblox adventurers! 🎮 🌠 The peeps here are super chill and friendly – it’s all about good vibes and cool...
socialanimerobloxfantasystrinova
L
Lexilon
1 votes
Dernier vote 55w ago
-Must be 18+ to join and stay, if you are suspected of being below the age of 18 you will have to verify or be removed. For safety reasons. -A large roleplay server with tons of information, but also is a hangout spot and casual spot for those looking to hangout. -Game-like features that make a...
roleplayfantasymagicloreerotic roleplay
A
𝐁𝐥𝐚𝐜𝐤𝐰𝐚𝐭𝐞𝐫 𝐁𝐚𝐲 (a +21 fantasy rp)
2 votes
Dernier vote 55w ago
We ID verify. This is a 21+, literate ERP server that focuses on worldbuilding as much as smut. Still under construction, but feel free to join and take a look around as we get set up! 𝐖𝐞𝐥𝐜𝐨𝐦𝐞 𝐭𝐨 𝐁𝐥𝐚𝐜𝐤𝐰𝐚𝐭𝐞𝐫 𝐁𝐚𝐲 . . . … a bustling town situated on the banks of the blackwater...
roleplayfantasyerpliterate21
S
𝖨 𝖭 𝖢 𝖤 𝖭 𝖣 𝖨 𝖴 𝖬.
247 votes
Dernier vote 56w ago
❝ 𝖳𝖧𝖤 𝖶𝖮𝖱𝖫𝖣 𝖨𝖲𝖭'𝖳 𝖲𝖯𝖫𝖨𝖳 𝖨𝖭𝖳𝖮 𝐆𝐎𝐎𝐃 𝐏𝐄𝐎𝐏𝐋𝐄 + 𝐃𝐄𝐀𝐓𝐇𝐄𝐀𝐓𝐄𝐑𝐒 ..    ( ❝ ) the halls of hogwarts  open  once  more,  and  this time, things  feel  different.  among  new  decrees, new faces, and new fears,  the  student body ...
roleplayharry potterliteratehogwartsfantasy
D
Dummies and Dragons
1 votes
Dernier vote 56w ago
We are a 16+ public Dungeons and Dragons server! What to know about us: A welcoming community for all, including but not limited to BiPOC, systems, LGBTQIA, and neurodivergent folks STAFF & SOCIAL MEDIA TEAM APPLICATIONS ARE OPEN! Beginner-friendly You can join as a player, a dungeon master, or a...
roleplayfantasyd ddnddungeons and dragons
S
𝓒𝓸𝓷𝓽𝓲𝓷𝓮𝓷𝓽 𝓸𝓯 𝓛𝓪𝓮𝓲𝓵𝓮
1 votes
Dernier vote 56w ago
Welcome to Laeile, a world populated by humans and the Lyrkans, monstrous half human half wolf creatures possessing powerful fire magic. This is a new RP (literally as of now I'm the only person ._.) that I wanted to start since I don't typically RP fantasy but I want to try it!! I only have very...
communityrpfantasynewliterate
D
Divinity Online
1 votes
Dernier vote 56w ago
{-}𝔻𝕚𝕧𝕚𝕟𝕚𝕥𝕪 𝕆𝕟𝕝𝕚𝕟𝕖{-} In the year 2278, VR technology has become mainstream in modern gaming. With the introduction of the AdvanceVisor, a revolutionary piece of “Virtual Dive” technology, millions of players could now access their dream full dive virtual reality games. One such game...
fantasyfantasy rpvirtual reality rpmmorpg rpvrmmorpg rp
N
New Gods
1 votes
Dernier vote 56w ago
★彡[ᴡᴇʟᴄᴏᴍᴇ ᴛᴏ ɴᴇᴡ ɢᴏᴅꜱ! ]彡★ ᴡᴇ ᴀʀᴇ ᴀ 16+ ꜱᴇᴍɪ-ʟɪᴛᴇʀᴀᴛᴇ ʀᴏʟᴇᴘʟᴀʏ ꜱᴇʀᴠᴇʀ ᴡɪᴛʜ ꜰᴀɴᴛᴀꜱʏ ᴀɴᴅ ᴘᴏꜱᴛ-ᴀᴘᴏᴄᴀʟʏᴘᴛɪᴄ ᴛʜᴇᴍᴇꜱ. ʜᴇʀᴇ ʏᴏᴜʀ ᴄʜᴀʀᴀᴄᴛᴇʀ ᴄᴀɴ ʙᴇ ᴀ ꜱɪᴍᴘʟᴇ ᴄɪᴛɪᴢᴇɴ ᴊᴜꜱᴛ ᴛʀʏɪɴɢ ᴛᴏ ʟɪᴠᴇ ᴛʜɪᴇʀ ʟɪꜰᴇ, ᴀ ꜱᴄʜᴏʟᴀʀ ꜱᴇᴇᴋɪɴɢ ᴛᴏ ᴜɴʟᴏᴄᴋ ᴛʜᴇ ꜱᴇᴄʀᴇᴛꜱ ᴏꜰ ᴍᴀɢɪᴄ, ᴀ ʜᴇʀᴏɪᴄ ᴀᴅᴠᴇɴᴛᴜʀᴇʀ ᴡʜᴏ ᴇxᴘʟᴏʀᴇꜱ ᴛʜᴇ ʀᴜɪɴꜱ ᴏꜰ ᴛʜᴇ ᴏʟᴅ...
roleplayrpfantasypost apocalypticoriginal characters
L
Lands of Spaera
2 votes
Dernier vote 56w ago
Well, hello there. No....that’s a cliche. Uhh... Aha! Wait no more! Oh wait no were not on TV now are we? Huh. It surprises me that you’ve gone this far reading into this boring attempt to advertise with success. Maybe you’ve gained interest? Who knows! ————(Page Break)———— Now, what do we have...
roleplayrpfantasymedievalkingdoms
T
The Last Sanctuary
2 votes
Dernier vote 56w ago
𝒯𝒽ℯ ℒ𝒶𝓈𝓉 𝒮𝒶𝓃𝒸𝓉𝓊𝒶𝓇𝓎 Long ago, an island was pulled from the sea. It called to the wayward and the lost to come settle its lands, and so they did. For a time, all the peoples lived in peace, with no wars between them. They named this place the "Island of the Dawn". Forty years ago,...
roleplayfantasysupernaturalvampirefae
S
♛♕♔•𝐓𝐡𝐞 𝐒𝐞𝐯𝐞𝐧 𝐊𝐢𝐧𝐠𝐝𝐨𝐦𝐬 𝐨𝐟 𝐀𝐞𝐭𝐡𝐞𝐫𝐢𝐚• ♛♕♔
1 votes
Dernier vote 56w ago
Welcome to the 7 Kingdoms on the continent of Aetheria, we are a 16+ server. We hope you come join us, and choose one of the kingdoms to reside within. Each kingdom is unique, and has many different types of people from all over, ranging from phoenixes, to fae, even elves and sirens. We are a...
roleplayfantasykingdomssirensfaeries
T
The Chronicles of Vivica (17+)
1 votes
Dernier vote 56w ago
°•✦•° The Vivicus Chronicles: Where the Story Unravels°•✦•° • ° ° . • ° . 。˚. ੈ ° . . 。˚. ੈ ✵• ° ° . • ° . 。˚. ੈ ° . . 。˚. ੈ ✵ ➤A magical world filled with diverse races and untold terrors of ancient origins! ➤Customizable abilities and magical attributes to tell the most epic odysseys of all...
roleplayfantasyadventuremagichigh fantasy
S
SHINWA.
1 votes
Dernier vote 56w ago
Shinwa is a roleplay server which follows the titular fantasy world. The world is a massive archipelago, a sprawling landscape of endless islands and seas, full of exotic creatures. In the world of Shinwa, there are many things to explore on the drowned planet's surface, many unique and vast...
roleplayrpfantasyfantasy rpanime rp
1
𝐍𝐨𝐫𝐭𝐡 𝐒𝐡𝐨𝐫𝐞 𝐂𝐡𝐫𝐨𝐧𝐢𝐜𝐥𝐞𝐬 [18+]
1 votes
Dernier vote 56w ago
Welcome to North Shore Chronicles! North Shore is a sprawling city with a rich history and a hidden world of supernatural factions. From the majestic heights of the angelic Celestia to the mysterious depths of the infernal Infernia, each faction has its own unique lore, culture, and territory...
roleplayrpfantasysupernaturalslice of life
G
Grand Universe Roleplay (RP): Fantasy and Sci-fi!
1 votes
Dernier vote 56w ago
We're the 𝐆𝐫𝐚𝐧𝐝 𝐔𝐧𝐢𝐯𝐞𝐫𝐬𝐞. We're a text-based RP/social server. We do prioritize roleplay and have done so for years. We're welcoming to new faces and ideas, so please join us if you'd like! We're 18+! FAQ (Frequently Asked Questions): Q. Are fandoms allowed? A. Yes. We allow OCs...
roleplayrpfantasyscififandom oc
S
𝐓𝐡𝐞 𝐌𝐲𝐬𝐭𝐢𝐜 𝐈𝐬𝐥𝐞𝐬: 𝐀 𝐍𝐞𝐰 𝐁𝐞𝐠𝐢𝐧𝐧𝐢𝐧𝐠
1 votes
Dernier vote 56w ago
╔════════.·:·.☽✧ ✦ ✧☾.·:·.════════╗ ꧁*。゚𝐖𝐞𝐥𝐜𝐨𝐦𝐞 𝐭𝐨 𝐭𝐡𝐞 𝐌𝐲𝐬𝐭𝐢𝐜 𝐈𝐬𝐥𝐞𝐬 。゚꧂ ╚════════.·:·.☽✧ ✦ ✧☾.·:·.════════╝ • ━ ⋅𖥔⋅ ━━ ✶ ━━ ✧ ━━ ✦ ━━ ✧ ━━ ✶ ━━ ⋅𖥔⋅ ━ • 𝘓𝘰𝘯𝘨 𝘢𝘨𝘰, 𝘸𝘩𝘦𝘯 𝘵𝘩𝘦 𝘔𝘺𝘴𝘵𝘪𝘤 𝘐𝘴𝘭𝘦𝘴 𝘸𝘦𝘳𝘦 𝘯𝘰𝘵 𝘺𝘦𝘵 𝘣𝘰𝘳𝘯 𝘪𝘯𝘵𝘰 𝘦𝘹𝘪𝘴𝘵𝘦𝘯𝘤𝘦,...
rpfantasymagickingdomroyalty
S
🌟Star Gazers☄
1 votes
Dernier vote 56w ago
Things to know!!! -SFW RP server -Si-fi RP -Supernatural RP Our limits on powers are not strict at all! we allow almost anything (though we do have a small black list and a application system with a universal level ban)
roleplayrpfantasymonsters
T
The Wild Waters- Roleplay
1 votes
Dernier vote 56w ago
Welcome to The Wild Waters, TWW is a semi-realistic fantasy, sandbox, text-to-text roleplay centered around humans and mers in a world filled with magic and wonder. Our goal is to create a welcoming and friendly community, while also providing a learning point for beginner roleplayers and engaging...
roleplayfantasypiratesfriendly communitymermaid
F
Fαɾҽɯҽʅʅ Wαɳԃҽɾlυʂƚ
9 votes
Dernier vote 56w ago
𝖶𝖾 𝖼𝗈𝗋𝖽𝗂𝖺𝗅𝗅𝗒 𝗂𝗇𝗏𝗂𝗍𝖾 𝗍𝗁𝗈𝗎 𝗍𝗈 𝗍𝗁𝖾 𝗄𝗂𝗇𝗀𝖽𝗈𝗆 𝗈𝖿 . . .⠀⠀ ͏͏͏ ͏͏͏ ͏͏͏ ͏͏͏ ͏͏͏⠀⠀ ↆ ⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀⠀ ⠀⠀⠀⠀ 𝐓𝐡𝐚𝐮𝐝𝐢𝐚! ⠀⠀∦ 𝖪𝗂𝗇𝗀 𝖬𝗒𝗌𝗍𝖺𝗋𝖺𝗅𝗍𝗁 𝗂𝗌 𝗁𝗈𝗅𝖽𝗂𝗇𝗀 𝖺 𝗀𝗋𝖺𝗇𝖽 𝖻𝖺𝗅𝗅 𝖿𝗈𝗋 𝖺𝗅𝗅 𝗈𝖿 𝗁𝗂𝗌 𝖼𝗂𝗍𝗂𝗓𝖾𝗇𝗌 𝖺𝗇𝖽 𝖺𝗅𝗅𝗂𝖾𝗌 𝗍𝗈...
roleplayfantasyrpmurder mysteryfantasia
S
;; salleria
1 votes
Dernier vote 56w ago
┄ ﹒ ⏳ ﹒ 𝑓𝑎𝑛𝑡𝑎𝑠𝑦 𝑠𝑒𝑟𝑣𝑒𝑟 ﹒ ✧ ﹒- ﹒ # 𝑖𝑛 𝑎 𝑓𝑎𝑟 𝑎𝑤𝑎𝑦 𝑤𝑜𝑟𝑙𝑑... A planet named Salleria exists. Salleria is home to 5 different kingdoms, all unique in their own way with rich culture... All with their own harrowing secrets... Each kingdom is the domain of a respective god,...
roleplayfantasy
T
The War of Imprisonment
1 votes
Dernier vote 56w ago
Welcome to The War of Imprisonment - A server dedicated to 2 things: Promoting the War of Imprisonment Series of books on AO3 & just about everything fantasy or scifi: From Legend of Zelda to Star Trek, Avatar to Lord of the Rings - if you like it, odds are we like it too! We try to be as chill...
gamingfantasynintendozeldafan fiction
...
Discordfy Logo

La meilleure plateforme pour découvrir et promouvoir des serveurs Discord. Rejoignez des milliers de communautés et trouvez des personnes partageant les mêmes intérêts.

Meilleurs serveurs

  • Serveurs de jeux
  • Serveurs d'anime
  • Serveurs minecraft
  • Serveurs sociaux

Ressources

  • Ajouter un serveur
  • Premium
  • Blog
  • Support

Légal

  • Conditions d'utilisation
  • Politique de confidentialité
  • Directives

© 2025 Discordfy. Tous droits réservés.

Discordfy.com n'est pas affilié à Discord.