Retour à l'accueil
Top Ranking

Anime Servers

Discover the best anime servers on Discord

2842 serveurs
Updated every 6 hours
H
Hotel Eclipse
0 votes
We will welcome you with open arms so feel free to join our non toxic community
animefunchillvcsocializing
E
Epsilons
0 votes
Developing server wanting to create a chill out space for anyone interested in anime, pop culture, meeting new people and making friends. Epsilons welcomes you and hope you can enjoy your time here. Please let me know if you have any suggestions. (also looking for staff members to join since we are...
socialdatinganimechillhangout
S
🌺 Sin City 🏙 •Social • Make friends 👥 • Hangout • Chill ☕• Games
0 votes
💬 Tons of cool people to meet! 🍥Active Server 🎁 Frequent Giveaways 💌 A very-welcoming server 🔊 Fun Voice Chats!
socialcommunitygaminganimerole play
S
: ̗̀➛𝘁𝗮𝘁𝗮𝗸𝗮𝗲
0 votes
.˚:teddy_bear:!˚˳ ⊹ baka bitch!꒷꒦˚ · · ────── ·☯︎︎· ────── · · ⊹꒷꒦what do we offer? ˚˳ ⊹ ꒷ ╭ʚ˚⊹꒷꒦︶︶꒷︶꒷꒦︶︶꒷꒦˚˳⊹ ┊ easy one-step verification ┊ anime, kpop and gaming chats! ┊ homework assistance/tutoring ┊ movie/show nights etc. ┊ partnerships ╰ʚ˚⊹꒷꒦︶︶꒷︶꒷꒦︶︶꒷꒦˚˳⊹
gaminganimekpopfriendsdrama
L
⌯﹒꒰꒰﹕Leitura Lunar﹒ଘ💜﹒ ☰
0 votes
✧﹒˃̵ᴗ˂̵﹕˃ᗜ˂﹒ꕀ﹒ᶻz﹒☆﹔⿴﹒✶﹒ᵔᴗᵔ﹒➜﹒⭔﹕⪩⪨﹐﹢﹐◒﹒⊂⊃﹔♡﹒◍﹒✦﹒ ◎﹐▨﹕Uma comunidade criada para ajudar outros escritores e artistas a divulgarem seus talentos! Somos um servidor seguro que respeita as diferenças. Venha divulgar suas obras!﹒✸﹒🔹﹒︶︶ ✧﹒˃̵ᴗ˂̵﹕˃ᗜ˂﹒ꕀ﹒ᶻz﹒☆﹔⿴﹒✶﹒ᵔᴗᵔ﹒➜﹒⭔﹕⪩⪨﹐﹢﹐◒﹒⊂⊃﹔♡﹒◍﹒✦﹒ link:...
mangamanhwafanficsarteslivros
S
ScoopCast
0 votes
This server is owned by the scoopcast team, group of 4 members their individual channel names are Moviestalks, SuperSuper, Desi Nerd, Vish. Scoopcast is a professional podcast channel which contains knowledge of pop-culture, anime, gaming etc.
gaminganimepop cultureindiaindians only
A
🍲 Anime Eataly 🍛
0 votes
Un server dove poter chillare e stare in vocale in compagnia per creare una piccola community che sappia rispettarsi e divertirsi 🍱 😍😍
communityanimeitaitalyitaliano
C
Cupids Association
0 votes
ೃ⁀➷ Welcome to ‘cupid’s association ’!*ੈ✩‧ We are a new but up coming anime matchmaking server! Our aim is to help people get matched and to bring ppl together :)! we aspire to be the biggest matchmaking server on discord and we can only do it with your help! We are very new so please be patient...
datingloveanimefriendsmatchmaking
N
NotGood
0 votes
Ultimate CODM Community Are you a Call of Duty Mobile enthusiast? Looking for a place to connect with fellow players, share tips, and strategies, and just have a great time? Look no further! 🌟 Welcome to N.O.T.G.O.O.D 🌟 What We Offer: Active Community; Game Nights; Tips & Tricks; Team Up; Voice...
communityanimechillcodmcodm clan
S
「🌻」𝐏𝐫𝐞𝐭𝐭𝐲 𝐆𝐚𝐫𝐝𝐞𝐧
0 votes
🌻- Pretty Garden ! ദ Olá, estou aqui convidando você para se juntar ao nosso servidor Pretty Garden! No nosso servidor temos um chat super ativo, sorteios, eventos, conversas sobre diversos jogos, animes e series e muito mais! Venha e conheça nossa comunidade! -...
animemangajogosconversaamizades
S
𝐒𝐜𝐚𝐫𝐥𝐞𝐭𝐕𝐚𝐧𝐢𝐚 (𝑻𝒉𝒆 𝑫𝒆𝒗𝒊𝒍'𝒔 𝑷𝒂𝒕𝒉) 𝐖𝐨𝐫𝐥𝐝
0 votes
≪•✟ 𝐒𝐜𝐚𝐫𝐥𝐞𝐭𝐕𝐚𝐧𝐢𝐚 (𝑻𝒉𝒆 𝑫𝒆𝒗𝒊𝒍'𝒔 𝑷𝒂𝒕𝒉) 𝐖𝐨𝐫𝐥𝐝 ✟•≫ •—————•°•🕀•°•—————•𝘜𝘱𝘥𝘢𝘵𝘦𝘴•—————•°•🕀•°•—————• 𝘝𝘦𝘳. 2.0 𝐈𝐍𝐓𝐑𝐎𝐃𝐔𝐂𝐓𝐈𝐎𝐍 Welcome to Scarletvania! We are a Touhou and vampire themed server with a grim reinassance aesthetics. The server concept is...
animeroleplayemotestouhouvampire
S
✧𝙼𝙷𝙰 𝚁𝙿✧
0 votes
We are a sfw non-toxic server for roleplaying and finding friends! We've got lots of CCs in the character list and we accept ocs!!
animeroleplaysfwnon toxicmha
V
Vanimetas
0 votes
Anime, Manga, Webtoon Botlar: ✓Mudae ✓Owo ✓ZeroTwo ✓RinBot ✓Yui ✓Bongo ✓Aki ✓FredBoat
animemangaturksohbetturk anime
J
Jujutsu World™ | JJK • Anime • Emotes • Events
0 votes
The new and official Jujutsu World™. We have anime events and anime channels where you can let all your anime opinions out without anyone being rude! We also welcome non-anime watchers! "𝘋𝘰𝘯'𝘵 𝘸𝘰𝘳𝘳𝘺, 𝘞𝘦 𝘢𝘳𝘦 𝘵𝘩𝘦 𝘴𝘵𝘳𝘰𝘯𝘨𝘦𝘴𝘵." - Jujutsu World
animemangaeventssocializejujutsu kaisen
F
freakyverse
0 votes
hi we're a super chill fun server .. we play roblox and vc a LOT and lowkey are awesome soooo join this serv to join an awesome sauce friend group WE HEART GOONING !!!!!!!!!!!!!!!!!!!!!!
animeautisticfreakyjjkcsm
E
Ekmek Yiyencikler
0 votes
kardeş ekmek fetişin varsa gel 31ci lolcülerin sevdiği bi sw e girllerimiz var ayak fotosu istersen o da var
animeotakuturkekmeklolcu selen
N
𖥔 no sleep — tokyo debunker
0 votes
a small and cozy tokyo debunker based server!! ask for advice, find new guilds, and bond with others over tokyo debunker :) newly made and active server, fun daily activities (question of the day, song of the day, polls)
gaminganimeotometokyo debunkertkydb
M
『Midnight Café』
0 votes
Welcome to『MIDNIGHT CAFÉ』 (Male owner) This is a 17+ ★𝙀𝙐 Based server that primarily focuses on Valorant and League of Legends. Please understand that this is a ★𝙉𝙀𝙒 server and follows the ★𝘽𝙎𝙏 timezone. (It is EU based as it is difficult to game with people in other areas, but you are...
gaminganimefriendsleague of legendsvalorant
F
Firenze Chill Corner🌙
0 votes
•°”˜𝑷𝒓𝒊𝒎𝒐(𝒆𝒅 𝒖𝒏𝒊𝒄𝒐) 𝒔𝒆𝒓𝒗𝒆𝒓 𝑵𝒆𝒓𝒅 𝑻𝒐𝒔𝒄𝒂𝒏𝒐 •°”˜ Benvenuti in Firenze Chill Corner, il luogo di ritrovo virtuale esclusivo per gli appassionati di anime, manga, gaming e lettura della regione toscana! Se sei un toscano o una toscana e ami immergerti nel mondo Nerd sei nel...
animechatitatoscanafirenze
I
Inazuma Ultimate
0 votes
⚡ Welcome to Inazuma Ultimate! ⚽ Embark on an electrifying journey through the legendary world of Inazuma Eleven in our immersive roleplay server! Here, you'll experience the magic of the anime from the original Inazuma Eleven all the way to Inazuma Eleven: Orion no Kokuin, with exciting new...
animeroleplayrpinazuma elevenenglish rp
S
𝕋ℝ𝕀ℙ𝕃𝔼 𝕏
0 votes
🌴Bienvenidos a Triple x comunidad muy pacífica habla pero mídete no todos tienen tu mismo humor! 🌴
socialanimemusicaespanoltriplex
T
Twilight | DMs ∘ Egirls ∘ VCs ∘ Non Dating ∘ Emotes
0 votes
(Fully SFW / Not An E-dating Server) DM-Based Server. The best and quickest way to meet your best friend! How does our server work? There are no text channels to speak in. Instead, you DM other people and talk there. | https://discord.gg/J7VxPcrV6H ━━━━━━━✦✗✦━━━━━━━━ Join Twilight...
socialdatinganimedmegirl
L
La Tilinbanda 🦦🤍
0 votes
Comunidad bien chidori dónde pasa de todo y no pasa nada. ★Roles actualizados. ★Canales de llamada activos. ★Comunidad amigable y sociable. ★Zona para hablar de fútbol Puedes hablar sin temor a cualquier administrador activo por si tienes alguna molestia con algún miembro y si sí, entonces le...
socialanimememesfemboyfutbol
M
Marc's E-Harem
0 votes
Welcome home! The floors may creak, the roof may leak, there is no power and no water, but the door is always unlocked to welcome the most peculiar of people.
communitygaminganime4chanegirls
M
ᄂMadHouseᄂ
0 votes
Benvenuti nel server MadHouse! Benvenuto Nella MadHouse! E' un server abbastanza piccolo, ma accogliente. Community sempre attiva, e si spera che il server cresci ancora di più. abbiamo staff sempre attivi a controllare le chat. Sperando che il server in cui potrete entrare sia comodo per...
communitygaminganime
F
𝄞⨾𓍢ִ໋ /Fyolai
0 votes
This is a small bungo stray dogs server!! ★ —– You can make friends here! ★ —– The server gets updated from to time ★ —– You can do anything you want in this server ★ —– Foreign language channels
communityanimefriendlyall agesbsd
T
TMC 26th Mech-Inf. Btn.
0 votes
Ohayou! My name is Soneko-nyan! Welcome to Project Sentai's community server! Me and team Marine Corps NEETs are working on a self release anime project that cross-overs with Touhou. The manga that I am writing - Sensou to Ai, is a military Yuri fantasy anime about cute girls with guns, since the...
animeyuritouhoumilitarydoujinshi project
S
【˗ˏˋMeraki´ˎ˗】
0 votes
˗ˏˋ ꒰ ♡ ꒱ ˎˊ˗ Meraki is a shifting server filled with a vibrant and active community, with friendly and engaging members from all over the world. It's got a fun, welcoming atmosphere that everyone can enjoy. But don't worry if you're not a shifter! You can still join, as the server is...
anime13multiverseshiftingreality shifting
G
Guild of Visions | Genshin Impact
0 votes
--> Guild of Visions is a Genshin Impact focused server with HSR and general interest channels ! ~ Only accepting members 15+ ~ When joining please read the rules, grab reaction roles and enjoy your time ! --> We mostly have members in NA, EU and Asia region ! ~ Very relaxed and open to helping...
gaminganimechillhangoutgenshin impact
S
☕ ❝ ᴀʀᴛɪꜱᴛ ᴄᴀꜰᴇ ❞ 🍰
0 votes
╔═.❥.═══════════════════════╗ ☕ ❝ ᴀʀᴛɪꜱᴛ ᴄᴀꜰᴇ ❞ 🍰 ¡bienvenid@s a a artist cafe!, somos una comunidad de artistas cuyo objetivo es divertir a las personas, conocer gente con tus mismos gustos e incluso poder mejorar en el ámbito del arte aquí dentro encontrarás... ◦˚✧ 1 ° ¡eventos cada dos...
animeartdrawingartedibujo
W
Waifu & Husbando Addicts
0 votes
⎯⎯⎯⎯ ✦ Welcome to Waifu & Husbando Addicts! ✦ ⎯⎯⎯⎯ We are a discord server that offers fun, friendly and competitive ways to play the bot known as Mudae. Our server operates at a Server Tier III (3) Level for Mudae meaning more rolls for everyone, higher chances at obtaining your favorite...
animemangacompetitivemudaeanimanga
O
orosbuoglusendeki
0 votes
I'll tell you what kind of men I really am! I have no strength, but I want it all. I have no knowledge, but all I do is dream. There's nothing I can do, but I struggle in vain like an idiot! I... I hate... I hate myself! All I do, is talk a big game and make myself sound like a big shot, when...
animemangaturksohbeteglence
J
Jojo's
0 votes
Discuss about jojo's in this server we can send memes and have fun you can also request things and ask becuase we will help whoever asks or in need of help
animejjbajojojojo bizzare adventurejojobizzareadventure
C
Celestial Paradise | Anime • Gaming • Art • Social • Chill • VC • Events
0 votes
🍰 Talk about Anime, Manga and Games while making new friends! 🎉 Fun server events everyone can enjoy! 🩷 Cute Anime Emotes and Stickers! 🎤 Active Chats and VC's 👋Stick around and help our Community Grow!
socialcommunitygaminganimeart
C
Chillz Max
0 votes
A Pokétwo-Based Server Friendly Staff 24x7 Spawns Daily Giveaways Daily Events Amazing Perks & Much More..! We will Always Welcome you to be a Part of our Community..!
gamesanimefunhangoutsfw
E
.epicord💀
0 votes
🔥 Welcome to .epicord 🔥 😈 We are the coolest people ever, what our server has to offer is: 💬 24/7 ACTIVE COMMUNITY! ‼️ BASED, RED PILLED & HUMOROUS MEMBERS OF OURS! 🎮 GAME NIGHTS AND EVENTS EVERY OTHER DAY! ⚠️ LITTLE TO NO RULES! 💎 LEVEL 3 BOOSTER PERKS 💯 Overall cool and EPIC server, we...
animememesdark humorsemi toxicshizo
D
✗ DGMDI ✗
0 votes
What does DGMDI mean? Don’t Get Mad Dumb Idiots <3 We are a fun chill-vibe server where you can joke around, but still be held accountable.
communityanimechillsfwgrunge
S
·˚ ༘ 𝐬𝐚𝐤𝐮𝐫𝐚 𝐥𝐞𝐚𝐯𝐞𝐬༉‧₊˚.
0 votes
₊˚ˑ༄˚ ༘♡ ·˚꒰sakura leaves ꒱ ₊˚ˑ༄ .ೃ࿐ - your local cutecore server ༉‧₊˚. .ೃ࿐ - safespace for everyone ༉‧₊˚. .ೃ࿐ - cute emojis and sticker ༉‧₊˚. .ೃ࿐ - Cutest community ༉‧₊˚. .ೃ࿐ - Giveaway at 100 members! ༉‧₊˚. ̥۪͙۪˚┊❛ NSFW STRICTLY FORBIDDEN ❜┊˚ ̥۪͙۪◌ ≡;- ꒰ °currently still growing ꒱
communityanimefriendskawaiisafespace
O
One Piece Is Real 🪙
0 votes
THE ONE PIECE... THE ONE PIECE IS REAL!!! 👍 | Join our server for: ⛵ | Active crew with 100+ pirates! 🎮 | A fun One Piece RPG game! ⏰ | Very cool counting channel! 👑 | One Piece forum with arcs/characters! 🌴 | and more!! ---> https://discord.gg/DKqvQ7CQxY
animeone pieceanime serverone piece serverthe one piece
W
Wakamiya
0 votes
Selam uzak diyarlardan gelen yabancı! Seni Wakamiya'da görmekten mutluluk duyacağımı şimdiden söylemek isterim. Wakamiya'da istediğin her şeyi bulabilirsin olur da bulamazsan (küçük minicik bir ihtimal) bizden isteyebilirsin. Eğer yapabileceğim bir şey ise bunu yapmaktan gerçekten mutluluk duyarım....
animeeglencelisakinc lg nkafa dengi
C
CHILLY VILLA
0 votes
Join if you want to have fun or if you like s-tox people or even if you want friendly people Like almost every kind of a human is present here From innocent to a freak to cat lover Any kind of PPL can be found here
gaminganimefriendlychillsemi toxic
B
blackout
0 votes
/joinblackout 700+ members from all over the globe BEST emojis and stickers to use ꉂꉂ(ᵔᗜᵔ*) Online staff ready to help you if needed ˚₊·—̳͟͞♡ We’re a welcoming community that LOVES chronically online users even better if you love to talk. :3 Don’t be shy to start a conversation we’ll be there to...
communitygaminganimekpopactive
S
SOUL PARADISE
0 votes
Welcome to SOUL PARADISE ...! 🎗 🎀 Welcome to SOUL PARADISE !! 🎗️🎁🎀 🧊We are an inclusive community of Chill & Anime fanatics! join with us & Chat , share your passion , make new friends and enjoy. 100 % SfW , Friendly & Non-Toxic environment. 🎨・ Anime Updates 🍁 ・ Anime Nights 📸 ・ Media 🤖...
communityanimefriendlyaestheticnontoxic
P
Pixel Domain™
0 votes
Welcome to Pixel Domain! 🌟 About Us: Pixel Domain is your ultimate hub for entertainment, Roblox, anime, and gaming! Whether you're a hardcore gamer, an anime enthusiast, or just looking for a fun and engaging community, you've found your new home. 🎮 Gaming Central: Dive into a variety of games...
communitygaminganimerobloxentertainment
S
/ 🍒 ‧˚ starlight ‧ ↩
0 votes
a wolverine server theme with multiple channels of other fandoms and free space to chat and share ideas such as art, music ect. Multiple things in progress such as nitro giveaways and more.
gaminganimemarvelmultiple fandomswolverine
...
...
Discordfy Logo

La meilleure plateforme pour découvrir et promouvoir des serveurs Discord. Rejoignez des milliers de communautés et trouvez des personnes partageant les mêmes intérêts.

Meilleurs serveurs

  • Serveurs de jeux
  • Serveurs d'anime
  • Serveurs minecraft
  • Serveurs sociaux

Ressources

  • Ajouter un serveur
  • Premium
  • Blog
  • Support

Légal

  • Conditions d'utilisation
  • Politique de confidentialité
  • Directives

© 2025 Discordfy. Tous droits réservés.

Discordfy.com n'est pas affilié à Discord.

Discordfy means Discord for you :D