Back to home

Anime Discord servers

Discover the best Discord servers in the anime category

communitygamingsocialanimeroleplaychillhangoutfriendsrobloxfunmusicartminecraftsfw
O
orosbuoglusendeki
0 votes
I'll tell you what kind of men I really am! I have no strength, but I want it all. I have no knowledge, but all I do is dream. There's nothing I can do, but I struggle in vain like an idiot! I... I hate... I hate myself! All I do, is talk a big game and make myself sound like a big shot, when...
animemangaturksohbeteglence
J
Jojo's
0 votes
Discuss about jojo's in this server we can send memes and have fun you can also request things and ask becuase we will help whoever asks or in need of help
animejjbajojojojo bizzare adventurejojobizzareadventure
C
Celestial Paradise | Anime • Gaming • Art • Social • Chill • VC • Events
0 votes
🍰 Talk about Anime, Manga and Games while making new friends! 🎉 Fun server events everyone can enjoy! 🩷 Cute Anime Emotes and Stickers! 🎤 Active Chats and VC's 👋Stick around and help our Community Grow!
socialcommunitygaminganimeart
C
Chillz Max
0 votes
A Pokétwo-Based Server Friendly Staff 24x7 Spawns Daily Giveaways Daily Events Amazing Perks & Much More..! We will Always Welcome you to be a Part of our Community..!
gamesanimefunhangoutsfw
E
.epicord💀
0 votes
🔥 Welcome to .epicord 🔥 😈 We are the coolest people ever, what our server has to offer is: 💬 24/7 ACTIVE COMMUNITY! ‼️ BASED, RED PILLED & HUMOROUS MEMBERS OF OURS! 🎮 GAME NIGHTS AND EVENTS EVERY OTHER DAY! ⚠️ LITTLE TO NO RULES! 💎 LEVEL 3 BOOSTER PERKS 💯 Overall cool and EPIC server, we...
animememesdark humorsemi toxicshizo
D
✗ DGMDI ✗
0 votes
What does DGMDI mean? Don’t Get Mad Dumb Idiots <3 We are a fun chill-vibe server where you can joke around, but still be held accountable.
communityanimechillsfwgrunge
S
·˚ ༘ 𝐬𝐚𝐤𝐮𝐫𝐚 𝐥𝐞𝐚𝐯𝐞𝐬༉‧₊˚.
0 votes
₊˚ˑ༄˚ ༘♡ ·˚꒰sakura leaves ꒱ ₊˚ˑ༄ .ೃ࿐ - your local cutecore server ༉‧₊˚. .ೃ࿐ - safespace for everyone ༉‧₊˚. .ೃ࿐ - cute emojis and sticker ༉‧₊˚. .ೃ࿐ - Cutest community ༉‧₊˚. .ೃ࿐ - Giveaway at 100 members! ༉‧₊˚. ̥۪͙۪˚┊❛ NSFW STRICTLY FORBIDDEN ❜┊˚ ̥۪͙۪◌ ≡;- ꒰ °currently still growing ꒱
communityanimefriendskawaiisafespace
O
One Piece Is Real 🪙
0 votes
THE ONE PIECE... THE ONE PIECE IS REAL!!! 👍 | Join our server for: ⛵ | Active crew with 100+ pirates! 🎮 | A fun One Piece RPG game! ⏰ | Very cool counting channel! 👑 | One Piece forum with arcs/characters! 🌴 | and more!! ---> https://discord.gg/DKqvQ7CQxY
animeone pieceanime serverone piece serverthe one piece
W
Wakamiya
0 votes
Selam uzak diyarlardan gelen yabancı! Seni Wakamiya'da görmekten mutluluk duyacağımı şimdiden söylemek isterim. Wakamiya'da istediğin her şeyi bulabilirsin olur da bulamazsan (küçük minicik bir ihtimal) bizden isteyebilirsin. Eğer yapabileceğim bir şey ise bunu yapmaktan gerçekten mutluluk duyarım....
animeeglencelisakinc lg nkafa dengi
C
CHILLY VILLA
0 votes
Join if you want to have fun or if you like s-tox people or even if you want friendly people Like almost every kind of a human is present here From innocent to a freak to cat lover Any kind of PPL can be found here
gaminganimefriendlychillsemi toxic
B
blackout
0 votes
/joinblackout 700+ members from all over the globe BEST emojis and stickers to use ꉂꉂ(ᵔᗜᵔ*) Online staff ready to help you if needed ˚₊·—̳͟͞♡ We’re a welcoming community that LOVES chronically online users even better if you love to talk. :3 Don’t be shy to start a conversation we’ll be there to...
communitygaminganimekpopactive
S
SOUL PARADISE
0 votes
Welcome to SOUL PARADISE ...! 🎗 🎀 Welcome to SOUL PARADISE !! 🎗️🎁🎀 🧊We are an inclusive community of Chill & Anime fanatics! join with us & Chat , share your passion , make new friends and enjoy. 100 % SfW , Friendly & Non-Toxic environment. 🎨・ Anime Updates 🍁 ・ Anime Nights 📸 ・ Media 🤖...
communityanimefriendlyaestheticnontoxic
P
Pixel Domain™
0 votes
Welcome to Pixel Domain! 🌟 About Us: Pixel Domain is your ultimate hub for entertainment, Roblox, anime, and gaming! Whether you're a hardcore gamer, an anime enthusiast, or just looking for a fun and engaging community, you've found your new home. 🎮 Gaming Central: Dive into a variety of games...
communitygaminganimerobloxentertainment
S
/ 🍒 ‧˚ starlight ‧ ↩
0 votes
a wolverine server theme with multiple channels of other fandoms and free space to chat and share ideas such as art, music ect. Multiple things in progress such as nitro giveaways and more.
gaminganimemarvelmultiple fandomswolverine
S
♰𝐇𝐞𝐥𝐥𝐬𝐢𝐧𝐠 𝐔𝐥𝐭𝐢𝐦𝐚𝐭𝐞 𝐅𝐚𝐧𝐜𝐥𝐮𝐛♰
0 votes
Hello, and welcome to the Hellsing Ultimate Fanclub! For those who don't know about hellsing, let me tell you a little about the history... Hellsing's Origins Hellsing was a Japanese manga series written and illustrated by Kouta Hirano. And was serialized in Shōnen Gahōsha's seinen manga magazine...
animeroleplayhellsingvampireshellsing ultimate
7
🌵 | 703 #5T
0 votes
Servidor oficial de México para mexicananas, mexicanos y gente que ama la cultura de este hermoso país. ✅ | Staff activo ✅ | Comunidad activa y amigable ✅ | Foro mexicano para hablar de lo que gustes. ✅ | Bots de minijuegos ✅ | Chats organizados ✅ | Sistema de roles y niveles ✅ | Sistema de...
socialanimeespanollatinoamericamexico
A
Anime Kingdom
0 votes
Hello! We are Anime Kingdom! We love meeting new people. Our server is about anime, manga, video games, music and more! We are an open LGBTQ+ friendly community. We offer a lot of cool things like: ➠ Friendly members ➠ Tons of cool emojis ➠ Profile pictures ➠ Art channels ➠ Bots ➠ Gaming ➠...
communitygaminganimechillgreek
S
⋆𝐕.
0 votes
Welcome to ⋆𝐕. , we're somewhat toxic various roles and channels + things to do you can be yourself decent moderation, genuinely just don't care anymore. chill community server founded in 7. 15. 2021
gaminganimechilleditingopium
S
مصرقعين الدسكورد
0 votes
ممنوع السب، ما يتفاعل كيك، الأحترام واجب، وجهك ما اعجبني باند، ممنوع اي مقاطع مخلة، ممنوع التكلم بالسياسة
communityanimechill
D
Dyu 10K!
0 votes
DYU 10K!!! Queremos ser mais do que apenas uma comunidade, queremos ser um refúgio para todos os nossos membros. Um lugar onde você pode contar com amigos para conversar, jogar, desabafa, se divertir e compartilhar experiências inesquecíveis. O que mais oferecemos a você? 🎀 • Comunidade ativa,...
animejogosbrasilamigosamizade
S
𝙀𝙣𝙩𝙞𝙩𝙮 𝙍𝙚𝙖𝙡𝙢
0 votes
Welcome the 𝙀𝙣𝙩𝙞𝙩𝙮 𝙍𝙚𝙖𝙡𝙢🩷 🍭 Estamos restabelecendo nosso clã, venha fazer parte desse recomeço mágico! 🍬 Amizades 🍪 Sorteios 🧁 Web namoro 🍫 Jogos e muito mais! 💮Embarque nessa ótima experiência💮 (⁠◕⁠ᴗ⁠◕⁠✿⁠)
gamesanimenitrogfweb namoro
D
Dragon Ball: The Forgetten
0 votes
Welcome to Dragon Ball: A Lost Timeline. We are a server where you can create your own strong and powerful characters as they go through the almighty trials and errors of a new era of Dragon Ball. what we offer -Welcoming and Accepting Community -LGBTQ+ friendly -Active Staff -Original...
animeroleplayrpdragon ball rpdbz rp
N
Nação AntiCLT 🚫
0 votes
server dedicado para interação social, mas não se engane por que não é bagunça! siga as regras e se divirta :D
communitygaminganimefriendschat
C
Chilzon
0 votes
kendi arkadaş ortamımıza yeni insanları da dahil etmek için public yapıverdik gelenler hoşgelmiş ㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤㅤ
animeleague of legendssohbet17valorant
T
‿ t♡ყ ྀི◟‿
0 votes
NOTTT A EGIRL SERVER!!! super silly and cool server that you should definitely join :3 huge pfp, custom banner, bio, layout and custom emote vault we play games like valorant, minecraft, roblox, fortnite, seige etc ! join if ur a cutie patootie :3 i promise we wont bite !!
gaminganimechillcutevalorant
S
🌷୭ 𝙨𝙖𝙠𝙪𝙧𝙖 𝙨𝙤𝙡𝙖𝙘𝙚 ✧ ˚. ᵎᵎ 🎀
0 votes
❛ ━━・🌸 w e l c o m e 🌸・━━ ❜ ︶︶︶︶༉‧₊˚. ıllı sakura solace is a discord server that offers a visually stunning and immersive experience its members ıllı the server provides a tranquil escape for users who appreciate the beauty of aesthetics and anime ıllı join today and experience the serenity of...
communityanimefriendlyaesthetic
F
Fitgirls
0 votes
16+ Join if you're looking for a small active community to make new friends (to chat and play games with). We've got self roles, random giveaways, gaming nights and random stuff to make your stay fun!
gamingdatinganimefriendsactive
O
Our Galaxy 🌌
0 votes
🌌✨ Welcome to ⭒.・゚✧ Our Galaxy ✧・゚.⭒ 🌌✨ 🚀 Initiating Launch Sequence... ✨ Destination: Our Galaxy... You’ve just entered a universe unlike any other, traveler. 🌠 A place where the stars align to bring together those who seek friendship, adventure, and a community as vibrant as the cosmos...
gamesminecraftanimemusicroblox
T
The Retro Room
0 votes
Retro gaming is a pretty niche hobby, especially for younger people. This server is a place for people, mainly teens, to discuss retro games and share their collections!
animepokemonnintendo13 19retro gaming
H
༘⋆🫧HoshiNeko ₊˚ෆ
0 votes
• • ︵︵︵︵︵╭ ( 𝑯𝒐𝒔𝒉𝒊𝑵𝒆𝒌𝒐 ) ╮︵︵︵︵︵ • • ❀...•ೃ ʙ ɪ ᴇ ɴ ᴠ ᴇ ɴ ɪ ᴅ ᴏ s "ᴰᵉˢᶜᵘᵇʳⁱᵉⁿᵈᵒ ᵉˡ ˢᵉᶜʳᵉᵗᵒ ᵈᵉ ˡᵒˢ ᵍᵃᵗᵒˢ ᶠᵉˡⁱᶜᵉˢ" ฅ~ 𝗦𝗼𝗰𝗶𝗮𝗹 - 𝗚𝗮𝗺𝗶𝗻𝗴 - 𝗔𝗻𝗶𝗺𝗲 • • ︵︵︵︵︵╭ (ʚ🪷ɞ˚) ╮︵︵︵︵︵ • •  ⥤ ¿Que Encontrarás? ଓ ୧ ‧₊˚ Chat Social ⁺◦ ฅ✧.* ୧ ‧₊˚ Auto-Roles ⁺◦ ฅ✧.* ୧ ‧₊˚ Mini Juegos ⁺◦...
socialgaminganimecomunidadespanol
A
♡Azalea♡
0 votes
°Helloo, welcome to Azalea! we would love to have more people here. °Its a pretty chill server sometimes really annoying though, can be very chatty. °We can talk about genshin, anime, manga and other games or shows or whatever anyone wants please give it a try! °we also have a whole section...
gamesanimemangahonkaigenshin impact
L
Lost Paradise // icons ৲ toxic ৲ com
0 votes
🌟 Welcome to Lost Paradise! 🌺 Dive into our vibrant world where anime reigns supreme, chill vibes are a given, and awesome company awaits. Hangout with the homies, connect with fellow otakus, and who knows? You might just catch the eye of some amazing girls! 💫 Brace yourself for semi-toxic fun...
socialcommunitydatinganimehangout
A
APEX_SOCIETY💫
0 votes
Welcome to Apex society! A great server for you and your friends to join and have a great time chatting! We offer great members and fun channels!
communitygamesanimefunchill
G
/gojo
0 votes
Anitok x Social Server E Girls Active Chats Events Daily Polls Giveaways Cool Bots Nice Level Roles And More Stuff Join /gojo rn y'all
animenarutoone piecedragon balljujutsu kaisen
S
sasaki & miyano
0 votes
Welcome to the Official Sasamiya Discord server for the anime adaptation of the BL manga Sasaki and Miyano! We are an active fun server to support the anime and manga and works of the creator. Come hang out with us! We have: Tons of original, handmade emotes from the anime and manga. Lots of...
animeblsasaki to miyanosasamiyakagihira
B
Bertão Streams
0 votes
Um server que podes encontrar amigos e pessoas incríveis como o próprio dono é um claro é um server que é de um streamer que quer crescer e entreter o maior numero de pessoas
socialgaminganimecomunidadeportugal
M
MoonBucks 2.0
0 votes
Walekum Pranam Qts 😻 Moonbucks mei aao ❤️‍🔥 🎊100 members in a week, keep joining pookies🎊 Kya kya milega? 🤔 👉🏻Active chat (aap aur active krdena🥰) 👉🏻Active vc channels (sab velle hai🤌🏻) 👉🏻Velli janta (males females sab hai💝) 👉🏻Friendly vibes (aap humare qt ho already😻) ‼️And...
gaminganimekdramaindiaindian
T
The SCCCOGIUSAMCAOFGACTGPFKPAVCOVGAC
0 votes
Small and friendly community server that has daily anime streaming night, as well as other upcoming events
communityanimestreamingvoice chatvc
A
Anata wa Hikikomori
0 votes
"Welcome to Anata wa hikikomori, a vibrant and welcoming Discord server dedicated to all things anime, manga, and more! Whether you're a seasoned otaku or just starting your journey into the world of Japanese pop culture, our community is the perfect place to connect with like-minded individuals,...
animemangahangoutsatirechillchat
S
𝐔𝐧𝐢𝐭𝐲
0 votes
〖🏮〗➣・✦ 𝐖𝐞𝐥𝐜𝐨𝐦𝐞 𝐭𝐨 𝐔𝐧𝐢𝐭𝐲. ✦ ╔═■══════════╗ ══════════════ ✦ 𝐉𝐉𝐊 𝐓𝐡𝐞𝐦𝐞𝐝 𝐀𝐜𝐭𝐢𝐯𝐞 𝐒𝐞𝐫𝐯𝐞𝐫 ✦ 〖🏮〗➣・𝐀𝐜𝐭𝐢𝐯𝐞 𝐜𝐡𝐚𝐭 〖🏮〗➣・𝐌𝐮𝐥𝐢𝐭𝐩𝐥𝐞 𝐟𝐚𝐧𝐝𝐨𝐦𝐬 〖🏮〗➣・𝐏𝐚𝐫𝐭𝐧𝐞𝐫𝐬𝐡𝐢𝐩𝐬 〖🏮〗➣・𝐄𝐯𝐞𝐧𝐭’𝐬 〖🏮〗➣・𝐋𝐆𝐁𝐓𝐐...
animeactivemangapartnershipjjk
L
lampy's server
0 votes
✨Looking for a place to relax, chat, and connect with new friends? Look no further! Our friendly and welcoming community is the perfect spot to hang out and have a great time.✨ --------------♡----------♡----------♡----------♡-------------- Vibrant Chat Rooms: From hobbies to gaming, music, and...
communityanimemusicbookswriting
S
𝙎𝙤𝙘𝙞𝙖𝙡 𝘼𝙗𝙮𝙨𝙨
0 votes
Haiii... ini Server yang Kamu Cari 👋 This is "Social Abyss" Fun And Friendly Discord Community Having Fun Together Looking for friends or maybe soulmate Sharing memes, picture, Music, Anime, Movie and more Playing game together want to chat together with temporary and private room Or playing...
gaminganimemusicmemeschill
V
VE$$EL
0 votes
Welcome to VESSEL! Are you looking for a friendly and talkative community where you can make new friends, share your love for gaming, and discuss your favorite anime? Look no further! VESSEL is the perfect place to connect with like-minded individuals in a positive and inclusive...
gaminganimefriendlymaking friendstalkative
S
˚₊‧꒰ surprising click ꒱ ‧₊˚
0 votes
𝐂𝐥𝐢𝐜𝐤 ! 🎞️ 🪶 Take your pause take your dream Welcome to ' ꒰ surprising click ꒱ ' ! The fan-run Neo Aurora Link Click roleplay server ! We offer a wide variety of features for our community 📷 15+ idol au roleplay 📷 An opportunity to meet new people with similar interests 📷 In and out...
animeroleplaydonghualink clickshiguang daili ren
L
luv
0 votes
hello i’m xio the owner of this server! welcome to bwurial! a place where you can chill and chat with your close/new friends! feel free to invite ur friends! i made this server because i wanted to create a space that everyone can enjoy and escape reality for a moment! enjoy your stay! 🖤🕸️
socialanimedaddysmommysekittens
...
...
Discordfy Logo

The best platform to discover and promote Discord servers. Join thousands of communities and find people with the same interests.

Top Servers

  • Gaming servers
  • Anime servers
  • Minecraft servers
  • Social servers

Resources

  • Add Server
  • Premium
  • Blog
  • Support

Legal

  • Terms of Service
  • Privacy Policy
  • Guidelines

© 2025 Discordfy. All rights reserved.

Discordfy.com is not affiliated with Discord.

Discordfy means Discord for you :D