Back to home
Top Ranking

Best Roleplay Discord Servers

Join immersive roleplay communities on Discord. Find creative writing groups and collaborative storytelling servers.

3424 servers
Updated every 6 hours
J
Jujutsu Kaisen - Cursed Conquest
0 votes
【 🏮 JUJUTSU KAISEN - CURSED CONQUEST 🏮 】 In 2025, seven years after Gojo's reign and Sukuna's reincarnation, the world bears the deep scars of their battle, shaping the world. Jujutsu Society's once-hidden existence is now public knowledge. The emergence of a new generation of Jujutsu Sorcerers,...
roleplayrpjujutsu kaisenjjkjjk rp
E
◜⧉﹐🌜 ⺡𝐋egend 𝐏iece 𝐑𝐏 — #²¹⁰⁰
0 votes
╭┈─────── ೄྀ࿐ ┆❝ 🎊₊๑ ╰舞 👑 𝙇𝙚𝙜𝙚𝙣𝙙 𝙋𝙞𝙚𝙘𝙚; 𝙍𝙋˚⊹₊˚ 氷 ╰┈──────────────➤ ﹒\🌜〢﹐Venha participar deste incrível servidor, convidamos a embarcar em uma jornada épica e repleta de originalidade no universo de One Piece. Abaixo, veja o que irá encontrar; ﹒「✨️」〢﹐Staff Ativa; Aqui temos uma...
rprpgone pieceoplegend piece
S
🔦 : 𝓒𝐚𝐦𝐩 𝓝𝐢𝐠𝐡𝐭𝐰𝐨𝐨𝐝 ·
0 votes
𝗣𝗟𝗔𝗬▶ 𝗩𝗛𝗦 🪓 : Welcome to 𝘾𝙖𝙢𝙥 𝙉𝙞𝙜𝙝𝙩𝙬𝙤𝙤𝙙, a newly opened horror-styled summer camp role play, with a developing plot and interesting world for you to emerge yourself into! 🪦 : 𝘞𝘏𝘈𝘛 𝘞𝘌 𝘖𝘍𝘍𝘌𝘙 14+ server, any NSFW content is kept in threads. Staff and killer...
rphorrorrole playsummer campcamp rp
D
Dreamscape of Terra
0 votes
What our server has: -An ongoing expansive lore. -A variety of rp categories and channels. (Over 70 rp channels and more to come!) -A variety of races to use for your OC. -A variety of locations and countries, a category for each country. -An expansive yet simple OC template. -Active owners. Our...
roleplayrpfantasymilitarysim lit
H
HEROES' ANTHESIS
0 votes
Welcome to Charlotte, North Carolina. The universe of HEROES’ ANTHESIS is one like our own, that changed suddenly in 2018. The outbreak of an alien virus had caused humans to begin developing what many would call “Superpowers.” While many didn’t receive these powers, those who had drawn their...
roleplayrpsupernaturalsuperheropowergen
N
Nevadan Era. [MPN RP]
0 votes
./. / /. ENTRY LOG - INTRO ./. /. . . / ./ Welcome to "Nevadan Era" Is a Madness Combat Roleplay just like any other. Here Is what we have. Friendly Community Storyline Semi-Serious Roleplay And others. So yea. ./. . /. . ENTRY LOG ENDS /. /. /. . .
roleplaynewgroundsmadness combatmadness project nexusmadness combat rp
L
𝐋𝐎𝐒𝐓 𝐇𝐎𝐏𝐄𝐒 𝐏𝐄𝐀𝐊 (L.H.P)
0 votes
If you are a fan of the Wild West and interested in an immersive experience full of adventure, this server is for you! Lost Hope's Peak takes you back to 1901, where you can create your own unique character and take part in various activities and challenges. You can explore the vast and detailed...
roleplayrdr2redmcfx
S
𝑪𝒉𝒂𝒐𝒕𝒊𝒄 𝑨𝒔𝒄𝒆𝒏𝒅𝒂𝒏𝒄𝒚│𝐑𝐏
0 votes
┍━━╝🌃✹𝐂𝐇𝐀𝐎𝐓𝐈𝐂 𝐀𝐒𝐂𝐄𝐍𝐃𝐀𝐍𝐂𝐘✹🌆╚━━┑ ° ੦ :➜: 📜 ┆ ꕀ﹕𝐁𝐈𝐎𝐆𝐑𝐀𝐅𝐈𝐀 • Em um mundo semelhante ao nosso, coisas estranhas acontecem. Desde aparecimentos bizarros, até seres poderosos que se disfarçam em meio aos homens. Uma liberdade criativa imensa que estende-se até os céus,...
roleplayrpbrasilbrherois e viloes
T
Toko Bangunan
0 votes
⠀⠀⠀⠀⠀.          ⠀⠀⠀✦ ⠀ ⠀      𝕾𝖊𝖈𝖔𝖓𝖉 𝕮𝖍𝖔𝖎𝖈𝖊        ⠀⠀⠀⠀⠀* ⠀⠀⠀.          .𝕴𝖑𝖑𝖊𝖌𝖆𝖑 ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀✦⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀𝕺𝖗𝖌𝖆𝖓𝖎𝖘𝖆𝖙𝖎𝖔𝖓⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀𝕮𝖗𝖎𝖒𝖊 ⠀⠀⠀⠀⠀⠀.             .   ゚ .             .                ✦...
roleplayrp animeroleplay indonesiarpa
E
Evil Teams Pokémon
0 votes
Welcome to Evil Teams Pokemon! A community thats mostly rp and lore based (though the rp just went through a reset) and about Pokemon evil teams! Anyone can make their own overarching story that people can participate in! Create your own evil team and try and take over the earth, or be a hero...
communitygamingrppokemonpokemon rp
S
♯ 🦉 ⸝⸝ 𝓜𝗔𝗥𝗔𝗨𝗗𝗘𝗥𝗦 ─ 𝟭𝟵𝟳𝟳
0 votes
_____________________ ︵ ♯ 🦉 ⸝⸝ 𝓜𝗔𝗥𝗔𝗨𝗗𝗘𝗥𝗦 ─ 1977 For the Marauders, it’s just another year. Seventh year, to be exact. Their final year at Hogwarts, something some of them have been waiting for since they stepped foot into Hogwarts during their first year. The year has only just begun,...
roleplayrphpharry pottermarauders
C
ʚ~⚬ Camp Sterling ⚬~ɞ
0 votes
═════════════【An Imaginative World Of Dreams】═════════════ We welcome you to a world beyond your wildest dreams with creatures straight from the imagination of the community. Camp Sterling is a roleplay server made particularly for those looking for a modern fantasy server decked out with royalty,...
roleplayfantasyeventsfantasy rproyal rp
U
UN | United Nations #ROADTO300
0 votes
Hello! We are a official UN community in Roblox as we do roleplay, politics, meetings and more! We are looking for more applying nations and more staff to come join us as we are hiring staff right now! So come join and have fun if you like roleplay and politics in Roblox!
politicsroleplayrobloxro nations
M
Melez Kampı Roleplay #Legacy
0 votes
Melez Kampı Roleplay sunucusuna hoş geldin, taze kan! Melez Kampı'nın girişlerini gören kişi, Sis'in ardına adım atabilmişsin bunun yalnızca tek açıklaması olabilir ki o da damarlarında ilahi kanın akmasıdır. Tanrıların evlatlarının zamanlarının geldiği, çok geride kalmış Kahramanlar Çağı'nın...
roleplaypercy jacksonturkce rpturk rpmelez kamp
S
𝕮𝖔𝖒𝖗𝖆𝖉𝖊𝖘 𝖂𝖊 𝕯𝖊𝖘𝖕𝖎𝖘𝖊
0 votes
˚꒦꒷🌱꒷.ᴄᴏᴍʀᴀᴅᴇꜱ ᴡᴇ ᴅᴇꜱᴘɪꜱᴇ˚ 🪴 ━━━━━━ ✿ ✫ ✿ ━━━━━━ All you know about the forest are its sharp nails hidden under the canopy of its trees, and all you know about your peers is the violence they have the capacity for. ━━━━━━ ✿ 🫁 ✿ ━━━━━━ Comrades We Despise is a roleplay that follows the children...
roleplayrphorrorhigh school rp
S
🔥 𝓢𝓦𝓖𝓡𝓞𝓛𝓔𝓟𝓛𝓐𝓨 🔥
0 votes
¡Bienvenidos a Star Wars Galaxies Roleplay! Somos la Comunidad de rol hispanohablante de Star Wars basada en nuestro propio servidor MMORPG para PC. Contamos con muchas opciones, un desarrollador que está en constante progreso, un director de rol que se encargará de que no se rompa ninguna de las...
roleplaystar warsmmorpgstar wars espanolswg
T
The Furpocalypse
0 votes
‘It’s been clear that our hubris would be the cause to our downfall…we just didn’t know that it would dawn on us so soon..’ ‘The Night Is As Dark As Just Before The Dawn, And I Promise You, The Dawn Is Coming’ -Harvey Dent. . . . Fifteen years ago a scientific experiment gone wrong destroyed...
roleplayzombiefurryrpapocalypse
A
ARCHVERSE
0 votes
Archverse is an Undertale roleplay server heavily inspired by Dreamswap. In it, a new force disrupts the multiverse in the form of Angel (previously known as Dream) and the Righteous Three: his deeply devoted followers. Will you take the brutal path of spreading Positivity through any means...
roleplayundertaleundertale rporiginal characterdeltarune
W
Warrior Cats: Rebuilt
0 votes
Disaster struck the forest, crumbling the very earth beneath every paw- The clans had no choice other than to escape. Every paw step, every crackle of the earth- It was what changed their fate between life or death. Clans got broken apart, utterly making the forest devoid of life-- Would the clans...
roleplaywarrior catswarriorswcrpwcue
1
𝐀𝐛𝐞𝐫𝐧𝐚𝐭𝐡𝐲, 𝟏𝟗𝟖𝟒【 18+ 】
0 votes
𝐈𝐟 𝐲𝐨𝐮'𝐫𝐞 𝐚 𝐟𝐚𝐧 𝐨𝐟 𝐬𝐦𝐚𝐥𝐥-𝐭𝐨𝐰𝐧 𝐡𝐨𝐫𝐫𝐨𝐫, 𝐭𝐡𝐞𝐧 𝐥𝐨𝐨𝐤 𝐧𝐨 𝐟𝐮𝐫𝐭𝐡𝐞𝐫... ⌜▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬⌝ 𝘖𝘯 𝘵𝘩𝘦 𝘴𝘶𝘳𝘧𝘢𝘤𝘦, 𝘈𝘣𝘦𝘳𝘯𝘢𝘵𝘩𝘺 𝘢𝘱𝘱𝘦𝘢𝘳𝘴 𝘵𝘰 𝘣𝘦 𝘵𝘩𝘦 𝘪𝘥𝘦𝘢𝘭 𝘱𝘭𝘢𝘤𝘦 𝘵𝘰 𝘭𝘪𝘷𝘦, 𝘸𝘪𝘵𝘩 𝘪𝘵𝘴 𝘷𝘦𝘳𝘥𝘢𝘯𝘵...
roleplayrphorror80ssmall town
W
❝ WELCOME TO CITY IRWELL ❞ _ ıllı
0 votes
Are you looking for a roleplay server with good lore? and roles? well join welcome to city irwell! (ref) " Three years after a Great War and the world is in a big decrease in its health. Constant crime and violence in the city that was once paradise, three areas of the city separated into the...
roleplayrpheroes and villainsroleplay servertcfsv
T
The Crystal Rose
0 votes
༓࿇♔ THE CRYSTAL ROSE ♔࿇༓ 18+ ONLY ┈ ┈ ┈ ━ ⋅𖥔⋅ ━━✶━━ ⋅𖥔⋅ ━ ┈ ┈ ┈ ♔ Step into a world where love and politics intertwine in The Crystal Rose! ♔ Join us for an immersive experience where courtly romance meets cunning intrigue. Will you be a noble seeking power through alliances, or a charming rogue...
roleplayfantasyroyal roleplaybridgerton roleplayroyal fantasy
M
Meursault
0 votes
🌟 Welcome to Shadowmare SMP! 🌟 ➡️ Forge 1.20.1 ⬅️ ⭐ Important - The server is RP based. So having a character is Mandatory. It's not that complicated you just have to be relevant to the server's lore. Also this is a server of a nation. You'll be a able to join the main server via this...
minecraftroleplaylorejavasmp
S
𝙘𝙝𝙖𝙞𝙣𝙨𝙖𝙬 𝙗𝙡𝙤𝙤𝙙 𓆩♡𓆪
0 votes
𝙘𝙝𝙖𝙞𝙣𝙨𝙖𝙬 𝙗𝙡𝙤𝙤𝙙! “𝙃𝙚𝙖𝙫𝙚𝙣 𝙫𝙨 𝙃𝙚𝙡𝙡” 1997, Tokyo Japan. The world has been facing devils since time began, and as humanity became one more devils were born in peoples fear. The government needed to put a stop to these devils harming society, creating public safety....
roleplayjjkchainsaw man rpcsm rp
B
(BNRP) The Era of Deviation || S. 3
0 votes
[👑]Era of Deviation (S1)[👑] [🌐]A Modern Day NRP[🌐] Over the years, Banat's NRP Server has solidified his position as a high-quality and well-respected roleplay server. Being one of the oldest currently active servers, taking advantage of dedication showcased by the Staff and Ownership, it has...
roleplaycountry rpcountry roleplaynrpnation roleplay
G
Gen V: Echoes
0 votes
Gen V: Echoes is a Gen V roleplay set at the start of the school year following the events of season one. Some lore changes have been made to avoid the bloody end to the season. We emphasize the plot and well-written characters. -We Are New and Have Many Canon Character openings! -Active...
roleplayrprole playgen vthe boys
L
Lines Of Reality: Forgotten Roots
0 votes
”The rule of threes…three minutes without air…three days without food…and three stories to a trilogy.” Killing games have been a part of humanity for decades. The first one involved the 67th class of Hopes Peak, and another occurred to the 82nd. Both ended in numerous gruesome and gory demises,...
roleplayocdanganronpakilling gamedanganronpa roleplay
E
Evergreen Academy
0 votes
(\ (\ („• ֊ •„) ━O━O━━━━━━━━━ ・:。𝐢𝐧𝐯𝐢𝐭𝐚𝐭𝐢𝐨𝐧「 ✉️ 」・:三 ━━━━━━━━━━━━━ Dear Y/N We hope this message finds you well. On behalf of Evergreen Academy, we are thrilled to extend a warm invitation to you for our upcoming event: Event: Evergreen Academy Annual Open House Invite Link:...
roleplayschoolgachagacha lifegacha club
S
-𝚛𝚘𝚕𝚎𝚙𝚕𝚊𝚢 𝚌𝚘𝚖𝚖𝚞𝚗𝚒𝚝𝚢•
0 votes
Hello! this is a roleplay finder server! Our server has been running up close to a year and so we'd love to welcome even more members! We have a special area for 18+ members to keep adults who dont wanna rp with minors.
roleplayoc roleplayrp finderroleplay finderomegle role play
U
Unknown Veil
0 votes
UNKNOWN VEIL === An unknown world, yet to be discovered by the pioneers of another. After a shattering of space and time, survivors from across the multiverse gather to unearth the secrets of the New World. Your old life is history... for better or worse. Will you explore this newly birthed realm...
roleplayrpd ddndwestmarch
S
Star Trek: Phoenix
0 votes
The year is 2481, amidst the turning tides of the Second Iconian War. Join the USS Phoenix as it boldly explores turbulent space, tackles threats and anomalies, and experiences firsthand the struggle for the very existence of the United Federation of Planets and its ideals! Star Trek: Phoenix is...
roleplayrpsci fistar trekstar trek roleplay
C
CIDADE FANTASMA
0 votes
E aí punk? Já se perguntou onde você poderia ir para jogar ou talvez até narrar seu próprio RPG de mesa? Sempre teve dificuldade para encontrar aquele player ou mestre que ressoasse com o seu estilo? Quem sabe queira procurar público para uma idéia sua? Então não precisa procurar mais. Seja bem...
rpd drpgdndrpg de mesa
L
Limits Broken
0 votes
'Hearthstone' is a center of technology and a magical marvel due to its very strategic location. Many wars have been fought around the city. As a result, many different types have interacted with the city before it became an autonomous City-State free from outside influence. To the best of its...
roleplayrpsci ficrpfantasu
T
The Lands of Atera
0 votes
"Across all my travels, I've never seen a more beautiful sight than the world I grew up in. A world of endless promise, a place where you have the power to seize your dreams and shape reality. With wonders as far as the eye can see, painting a picture more beautiful than life itself. Seek for what...
roleplayrpfantasymedievalfantasy rp
C
Camp Half-Blood: Enlightened
0 votes
Hello, Welcome to Camp Half-Blood: Enlightened Let me ask you a Question? Do you like the books of Percy Jackson and The Olympians? Also Do you like RolePlaying with people? If you do! I have some fanatic news! Here at Camp Half-Blood: Enlightened we offer all of those things! And more! Let me...
rplgbtqpercy jacksonpjochb
D
🌌 D&D Arabian Nights
0 votes
This is an Arabic-Based D&D 5e server with 100% English support! Pretty much everything is translated and can be fully played that way. نحن سيرفر جديد الى التنانين والزنارين، ونقدم مغامرات صوتية ونصية قصيرة وألعاب دور! نحن ايضا نبحث عن رواة القصص جدد ولاعبين متحمسين يريدون استكشاف العديد من عوالم...
roleplayrplfgd ddungeons and dragons
D
✱ ding! ⭑ crossover text rp
0 votes
what's this? ⭑ characters from different universes suddenly get added to an online groupchat — upon close inspection, nobody is able to leave the chatroom. instead of the leave button, they find a button labeled " warp ", which may allow them to teleport themselves or various objects to other...
roleplaymultifandomcrossovertextingtexting roleplay
C
🏛﹒CAMP HALF BLOOD﹒⺌﹒
0 votes
🐚﹒A book based Percy Jackson rp server! OCS are accepted! System and neurodivergent friendly Super nice and cool mods Drama will not be tolerated so expect a super chill fun server! Simple character form, and rp rules - Uhh join today to be apart of the cool kids﹒⺌﹒
roleplaycamp half bloodpercy jacksoncamp half blood rppercy jackson rp
S
𝓡𝓸𝓼𝓮𝓶𝓮𝓲𝓾𝓼 𝓐𝓬𝓪𝓭𝓮𝓶𝔂
0 votes
. 【🌹 𝓡𝓸𝓼𝓮𝓶𝓮𝓲𝓾𝓼 𝓐𝓬𝓪𝓭𝓮𝓶𝔂 🌹】 . ================================================================================================================= You have been accepted into Rosemeius Academy, the most prestigious magical academy in all of the world of Skybound. You begin as a first...
roleplayfantasyrpgmagicmagic school
F
Fortress of the Golden Sands
0 votes
The sands have shifted, ushering in an era of revolution and the twisting of fates... You are a native of these lands, born to one of the ancient and rich biomes therein, and it seems the call for adventure has reached you in all of its grandeur! The world is fresh, a plentiful harvest grown to...
roleplayd ddnd5ewestmarch
J
Jujutsu Kaisen: Advanced Era
0 votes
Jujutsu Kaisen: End Era! • Jujutsu Kaisen: End era se passa na era moderna (atual) de Jujutsu, contendo personagens do próprio anime aqui e ali. • Funciona por rolagens de dados e comandos, mas nada te impede de fazer uma ação levemente mais detalhada para tornar a batalha mais dinâmica e menos...
rpjujutsu kaisenjujutsu kaisen rp
S
SAO: Elysium
0 votes
O melhor e maior RPG de Mesa de Sword Art Online do Brasil! Jogue 24h com dezenas de jogadores, sistema de automação único, Bots Exclusivos, suporte ativo, comunidade engajada. Conheça o seu Kirito ou Asuna neste servidor imperdível! Ambientado mundo vasto e misterioso, totalmente ambientado no...
socialgamesroleplayrpbrasil
K
︳﹙🧭﹚❝ Kaizoku no Jidai — 1.0 #800
0 votes
Um clássico servidor de One Piece está de volta, o Kaizoku no Jidai! Com sistemas reestruturados, comunidade respeitosa, staffers ativos e muito mais; buscamos oferecer uma ótima experiência a todos os membros. Venha para o mais incrível RP baseado na obra One Piece!
rprpgone pieceone piece rpone piece rpg
A
After Hours DOJ Fivem Interview Server
0 votes
We hope to see you apart of the AHDOJ Family soon! About Us: After Hours DOJ is a FiveM Roleplay Community created back in July of 2021. We are a group that is always looking to bring people together for a great roleplay experience. Our community is a mature and safe space for all. Every member of...
roleplayfivemrecruitmentwhitelistedqb core
B
˚₊‧꒰BL33DINGHE4RT’S DOMAIN꒱‧₊˚
0 votes
Welcome to bleeding hearts domain, where gacha creators chill and make videos! we are a friendly community, no rudeness what so ever! we would appreciate you joining our community <3
roleplaygachacreatorstiktokgachalife
...
...
Discordfy Logo

The best platform to discover and promote Discord servers. Join thousands of communities and find people with the same interests.

Top Servers

  • Gaming servers
  • Anime servers
  • Minecraft servers
  • Social servers

Resources

  • Add Server
  • Premium
  • Blog
  • Support

Legal

  • Terms of Service
  • Privacy Policy
  • Guidelines

© 2025 Discordfy. All rights reserved.

Discordfy.com is not affiliated with Discord.

Discordfy means Discord for you :D